BIRC8 (baculoviral IAP repeat containing 8)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 112401
• Gene name: Baculoviral IAP repeat containing 8
• Gene symbol: BIRC8
• Synonyms (NCBI Gene): ILP-2, ILP2, RNF136, hILP2
• Chromosome: 19
• Chromosome location: 19q13.42

miRNA Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT821703	hsa-miR-377	CLIP-seq
MIRT821704	hsa-miR-499-3p	CLIP-seq
MIRT821705	hsa-miR-499a-3p	CLIP-seq
MIRT821706	hsa-miR-627	CLIP-seq
MIRT821703	hsa-miR-377	CLIP-seq
MIRT821704	hsa-miR-499-3p	CLIP-seq
MIRT821705	hsa-miR-499a-3p	CLIP-seq
MIRT821706	hsa-miR-627	CLIP-seq
MIRT821703	hsa-miR-377	CLIP-seq
MIRT821704	hsa-miR-499-3p	CLIP-seq
MIRT821705	hsa-miR-499a-3p	CLIP-seq
MIRT821706	hsa-miR-627	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA

Other IDs

• MIM: 621072
• HGNC: 14878
• e!Ensembl: ENSG00000293247

Protein

• UniProt ID: Q96P09
• Protein name: Baculoviral IAP repeat-containing protein 8 (Inhibitor of apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) (Testis-specific inhibitor of apoptosis)
• Protein function: Protects against apoptosis mediated by BAX.
• PDB: 1XB0 , 1XB1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00653	BIR	7 → 70	Inhibitor of Apoptosis domain	Domain
  PF13920	zf-C3HC4_3	185 → 229		Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis specific in normal tissues.
• Sequence:

  MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHA
  KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIR
  MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPL
  RRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS

• Sequence length: 236

Related Genes

No strongly related genes found yet for BIRC8.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BIRC8.