BIN2 (bridging integrator 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51411
• Gene name: Bridging integrator 2
• Gene symbol: BIN2
• Synonyms (NCBI Gene): BRAP-1
• Chromosome: 12
• Chromosome location: 12q13.13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT821506	hsa-miR-4436b-5p	CLIP-seq
MIRT821507	hsa-miR-568	CLIP-seq
MIRT821508	hsa-miR-569	CLIP-seq
MIRT2181608	hsa-miR-326	CLIP-seq
MIRT2181609	hsa-miR-330-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001891	Component	Phagocytic cup	IBA
GO:0001891	Component	Phagocytic cup	IDA	23285027
GO:0001891	Component	Phagocytic cup	IEA
GO:0002102	Component	Podosome	IBA
GO:0002102	Component	Podosome	IDA	23285027
GO:0005515	Function	Protein binding	IPI	10903846, 23185384, 32296183, 33961781
GO:0005543	Function	Phospholipid binding	IBA
GO:0005543	Function	Phospholipid binding	IDA	23285027
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0006911	Process	Phagocytosis, engulfment	IBA
GO:0006911	Process	Phagocytosis, engulfment	IMP	23285027
GO:0016020	Component	Membrane	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042995	Component	Cell projection	IEA
GO:0060326	Process	Cell chemotaxis	IMP	23285027
GO:0070161	Component	Anchoring junction	IEA
GO:0071800	Process	Podosome assembly	IBA
GO:0071800	Process	Podosome assembly	IMP	23285027
GO:0097320	Process	Plasma membrane tubulation	IBA
GO:0097320	Process	Plasma membrane tubulation	IDA	23285027
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 605936
• HGNC: 1053
• e!Ensembl: ENSG00000110934

Protein

• UniProt ID: Q9UBW5
• Protein name: Bridging integrator 2 (Breast cancer-associated protein 1)
• Protein function: Promotes cell motility and migration, probably via its interaction with the cell membrane and with podosome proteins that mediate interaction with the cytoskeleton. Modulates membrane curvature and mediates membrane tubulation. Plays a role in p
• PDB: 4AVM , 4I1Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03114	BAR	17 → 237	BAR domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in natural killer cells (at protein level). Highest level expression seen in spleen and peripheral blood leukocytes and is also expressed at high levels in thymus, colon and placenta, suggesting preferential expression in hema
• Sequence:

  MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKL
  YKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQ
  AVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKA
  QTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEK
  QHSNKVFVVKGLSSSSRRSLVISPPVRTATVSSPLTSPTSPSTLSLKSESESVSATEDLA
  PDAAQGEDNSEIKELLEEEEIEKEGSEASSSEEDEPLPACNGPAQAQPSPTTERAKSQEE
  VLPSSTTPSPGGALSPSGQPSSSATEVVLRTRTASEGSEQPKKRASIQRTSAPPSRPPPP
  RATASPRPSSGNIPSSPTASGGGSPTSPRASLGTGTASPRTSLEVSPNPEPPEKPVRTPE
  AKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISANSSEGQDQLQVS
  MVPENNNLTAPEPQEEVSTSENPQL

• Sequence length: 565

Pathways

Reactome Pathway

Neutrophil degranulation

Signaling by membrane-tethered fusions of PDGFRA or PDGFRB

Related Genes

No strongly related genes found yet for BIN2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BIN2.