BICD1 (BICD cargo adaptor 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 636
• Gene name: BICD cargo adaptor 1
• Gene symbol: BICD1
• Synonyms (NCBI Gene): BICD, bic-D 1
• Chromosome: 12
• Chromosome location: 12p11.21
• Summary: This gene encodes an adaptor protein that belongs to the bicaudal D family of dynein cargo adaptors. The encoded protein acts as an intracellular cargo transport cofactor that regulates the microtubule-based loading of cargo onto the dynein motor complex.

miRNA Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026457	hsa-miR-192-5p	Microarray	19074876
MIRT045284	hsa-miR-186-5p	CLASH	23622248
MIRT821368	hsa-miR-142-5p	CLIP-seq
MIRT821369	hsa-miR-3146	CLIP-seq
MIRT821370	hsa-miR-3646	CLIP-seq
MIRT821371	hsa-miR-513a-3p	CLIP-seq
MIRT821372	hsa-miR-548a-5p	CLIP-seq
MIRT821373	hsa-miR-548ab	CLIP-seq
MIRT821374	hsa-miR-548ak	CLIP-seq
MIRT821375	hsa-miR-548b-5p	CLIP-seq
MIRT821376	hsa-miR-548c-5p	CLIP-seq
MIRT821377	hsa-miR-548d-5p	CLIP-seq
MIRT821378	hsa-miR-548h	CLIP-seq
MIRT821379	hsa-miR-548i	CLIP-seq
MIRT821380	hsa-miR-548j	CLIP-seq
MIRT821381	hsa-miR-548k	CLIP-seq
MIRT821382	hsa-miR-548l	CLIP-seq
MIRT821383	hsa-miR-548p	CLIP-seq
MIRT821384	hsa-miR-548w	CLIP-seq
MIRT821385	hsa-miR-548y	CLIP-seq
MIRT821386	hsa-miR-559	CLIP-seq
MIRT1942808	hsa-miR-143	CLIP-seq
MIRT821370	hsa-miR-3646	CLIP-seq
MIRT1942809	hsa-miR-4768-3p	CLIP-seq
MIRT1942810	hsa-miR-4770	CLIP-seq

Gene ontology (GO) Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	9367685
GO:0005515	Function	Protein binding	IPI	17139249, 20089649, 21988832, 32079660
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	17139249
GO:0005794	Component	Golgi apparatus	IDA	17562788
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	12447383, 20089649
GO:0005813	Component	Centrosome	IMP	17139249
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	12447383
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	NAS	9367685
GO:0005881	Component	Cytoplasmic microtubule	IDA	20089649
GO:0006396	Process	RNA processing	TAS	9367685
GO:0008093	Function	Cytoskeletal anchor activity	IBA
GO:0008093	Function	Cytoskeletal anchor activity	IDA	12447383
GO:0008093	Function	Cytoskeletal anchor activity	IEA
GO:0008298	Process	Intracellular mRNA localization	NAS	9367685
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9367685
GO:0016020	Component	Membrane	IDA	12447383
GO:0019068	Process	Virion assembly	IMP	20089649
GO:0019901	Function	Protein kinase binding	IPI	17139249
GO:0031267	Function	Small GTPase binding	IPI	12447383
GO:0031410	Component	Cytoplasmic vesicle	IDA	12447383, 20089649
GO:0031871	Function	Proteinase activated receptor binding	ISS	20164183
GO:0033365	Process	Protein localization to organelle	IBA
GO:0034063	Process	Stress granule assembly	ISS
GO:0034452	Function	Dynactin binding	IBA
GO:0034452	Function	Dynactin binding	IDA	12447383
GO:0034452	Function	Dynactin binding	IPI	17139249
GO:0045054	Process	Constitutive secretory pathway	TAS	20089649
GO:0045505	Function	Dynein intermediate chain binding	IBA
GO:0045505	Function	Dynein intermediate chain binding	IDA	17139249
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IBA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IMP	20164183
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20089649
GO:0048471	Component	Perinuclear region of cytoplasm	IMP	17139249
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IGI	17139249
GO:0070840	Function	Dynein complex binding	IBA
GO:0070840	Function	Dynein complex binding	IDA	12447383
GO:0070840	Function	Dynein complex binding	IEA
GO:0072385	Process	Minus-end-directed organelle transport along microtubule	IMP	12447383
GO:0072393	Process	Microtubule anchoring at microtubule organizing center	IBA
GO:0072393	Process	Microtubule anchoring at microtubule organizing center	ISS	19825938
GO:0099503	Component	Secretory vesicle	IDA	20089649
GO:1900737	Process	Negative regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1904781	Process	Positive regulation of protein localization to centrosome	IGI	17139249

Other IDs

• MIM: 602204
• HGNC: 1049
• e!Ensembl: ENSG00000151746

Protein

• UniProt ID: Q96G01
• Protein name: Protein bicaudal D homolog 1 (Bic-D 1)
• Protein function: Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09730	BicD	74 → 799	Microtubule-associated protein Bicaudal-D	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain, heart and skeletal muscle.
• Sequence:

  MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYD
  SLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSR
  AVVTNVQAENERLTAVVQDLKENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENI
  TLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKN
  EREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPNNDDKMNGHIHGPLVKLNGDY
  RTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQESQTQLEHTKGA
  LTEQHERVHRLTEHVNAMRGLQSSKELKAELDGEKGRDSGEEAHDYEVDINGLEILECKY
  RVAVTEVIDLKAEIKALKEKYNKSVENYTDEKAKYESKIQMYDEQVTSLEKTTKESGEKM
  AHMEKELQKMTSIANENHSTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQ
  SRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTI
  SPVITAPPSSPVLDTSDIRKEPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAAARELA
  PMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMV
  TETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLL
  RMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKVSGEASVTVPTIDTYLLHSQ
  GPQTPNIRVSSGTQRKRQFSPSLCDQSRPRTSGASYLQNLLRVPPDPTSTESFLLKGPPS
  MSEFIQGHRLSKEKRLTVAPPDCQQPAASVPPQCSQLAGRQDCPTVSPDTALPEEQPHSS
  SQCAPLHCLSKPPHP

• Sequence length: 975

Pathways

KEGG Pathway:

Viral life cycle - HIV-1

Reactome Pathway:

COPI-independent Golgi-to-ER retrograde traffic

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	20709820	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	19010793	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	20686608	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29538353		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	29538353	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20709820		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	36221106	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	20709820, 25154699	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing Loss	Hearing loss	Pubtator	37240244	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	GWASDB_DG	20686608		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	20686608		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	37240244	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20709820, 32234053	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	GWASCAT_DG	20709820		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	20709820, 21778810, 25154699		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28635954		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

BICD2 2 shared pathwaysViral life cycle - HIV-1, COPI-independent Golgi-to-ER retrograde traffic Related via 2 shared pathways including Viral life cycle - HIV-1, COPI-independent Golgi-to-ER retrograde traffic. TP53 2 shared diseasesEmphysema, Pancreatic cancer 1 shared evidence sourceGWAS catalog (Pancreatic cancer) Related via 2 shared diseases including Emphysema, Pancreatic cancer — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
BICD2	0	[]	2	["Viral life cycle - HIV-1","COPI-independent Golgi-to-ER retrograde traffic"]	0	[]
TP53	2	["Emphysema","Pancreatic cancer"]	0	[]	1	["GWAS catalog (Pancreatic cancer)"]

Diseases Linked via Similar Genes

Amyotrophic lateral sclerosis Linked via 2 of 2 related genesBICD2, TP53 Hemorrhoid Linked via 2 of 2 related genesBICD2, TP53 Arthrogryposis multiplex congenita Linked via 1 of 2 related genesBICD2 Autism Linked via 1 of 2 related genesBICD2 Childhood-onset spinal muscular atrophy Linked via 1 of 2 related genesBICD2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Amyotrophic lateral sclerosis	2	["BICD2","TP53"]
Hemorrhoid	2	["BICD2","TP53"]
Arthrogryposis multiplex congenita	1	["BICD2"]
Autism	1	["BICD2"]
Childhood-onset spinal muscular atrophy	1	["BICD2"]