BGN (biglycan)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 633
• Gene name: Biglycan
• Gene symbol: BGN
• Synonyms (NCBI Gene): DSPG1, MRLS, PG-S1, PGI, SEMDX, SLRR1A
• Chromosome: X
• Chromosome location: Xq28
• Summary: This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and

SNPs Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs879255604	A>G	Pathogenic	Missense variant, coding sequence variant
rs879255605	G>T	Pathogenic	Missense variant, coding sequence variant
rs886037823	G>A	Pathogenic	Stop gained, coding sequence variant
rs886037824	A>C	Pathogenic	Missense variant, coding sequence variant
rs886037825	G>A	Pathogenic	Missense variant, coding sequence variant
rs1602981402	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1602981441	->AA	Likely-pathogenic	Coding sequence variant, frameshift variant

miRNA Show/Hide all (244)

miRTarBase ID	miRNA	Experiments	Reference
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT635492	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	24906430
MIRT517400	hsa-miR-6758-5p	PAR-CLIP	22012620
MIRT517399	hsa-miR-6856-5p	PAR-CLIP	22012620
MIRT517398	hsa-miR-3125	PAR-CLIP	22012620
MIRT517396	hsa-miR-3916	PAR-CLIP	22012620
MIRT517397	hsa-miR-6859-5p	PAR-CLIP	22012620
MIRT517395	hsa-miR-4476	PAR-CLIP	22012620
MIRT517394	hsa-miR-6876-5p	PAR-CLIP	22012620
MIRT517393	hsa-miR-4533	PAR-CLIP	22012620
MIRT517400	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT517399	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT517398	hsa-miR-3125	PAR-CLIP	23446348
MIRT517396	hsa-miR-3916	PAR-CLIP	23446348
MIRT517397	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT517395	hsa-miR-4476	PAR-CLIP	23446348
MIRT517394	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT517393	hsa-miR-4533	PAR-CLIP	23446348
MIRT517398	hsa-miR-3125	PAR-CLIP	27292025
MIRT517396	hsa-miR-3916	PAR-CLIP	27292025
MIRT517395	hsa-miR-4476	PAR-CLIP	27292025
MIRT517393	hsa-miR-4533	PAR-CLIP	27292025
MIRT517400	hsa-miR-6758-5p	PAR-CLIP	27292025
MIRT517399	hsa-miR-6856-5p	PAR-CLIP	27292025
MIRT517397	hsa-miR-6859-5p	PAR-CLIP	27292025
MIRT517394	hsa-miR-6876-5p	PAR-CLIP	27292025
MIRT517398	hsa-miR-3125	HITS-CLIP	27418678
MIRT517398	hsa-miR-3125	HITS-CLIP	27418678
MIRT517398	hsa-miR-3125	HITS-CLIP	27418678
MIRT517398	hsa-miR-3125	HITS-CLIP	27418678
MIRT517396	hsa-miR-3916	HITS-CLIP	27418678
MIRT517396	hsa-miR-3916	HITS-CLIP	27418678
MIRT517396	hsa-miR-3916	HITS-CLIP	27418678
MIRT517396	hsa-miR-3916	HITS-CLIP	27418678
MIRT614284	hsa-miR-4311	HITS-CLIP	27418678
MIRT517395	hsa-miR-4476	HITS-CLIP	27418678
MIRT517395	hsa-miR-4476	HITS-CLIP	27418678
MIRT517395	hsa-miR-4476	HITS-CLIP	27418678
MIRT517395	hsa-miR-4476	HITS-CLIP	27418678
MIRT517393	hsa-miR-4533	HITS-CLIP	27418678
MIRT517393	hsa-miR-4533	HITS-CLIP	27418678
MIRT517393	hsa-miR-4533	HITS-CLIP	27418678
MIRT517393	hsa-miR-4533	HITS-CLIP	27418678
MIRT517400	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT517400	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT517400	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT517400	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT517399	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT517399	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT517399	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT517399	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT517397	hsa-miR-6859-5p	HITS-CLIP	27418678
MIRT517397	hsa-miR-6859-5p	HITS-CLIP	27418678
MIRT517397	hsa-miR-6859-5p	HITS-CLIP	27418678
MIRT517397	hsa-miR-6859-5p	HITS-CLIP	27418678
MIRT517394	hsa-miR-6876-5p	HITS-CLIP	27418678
MIRT517394	hsa-miR-6876-5p	HITS-CLIP	27418678
MIRT517394	hsa-miR-6876-5p	HITS-CLIP	27418678
MIRT517394	hsa-miR-6876-5p	HITS-CLIP	27418678
MIRT607442	hsa-miR-8485	HITS-CLIP	27418678
MIRT736304	hsa-miR-206	Luciferase reporter assay, RNA-seq, qRT-PCR	32129700
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT635492	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT614284	hsa-miR-4311	HITS-CLIP	23824327
MIRT607442	hsa-miR-8485	HITS-CLIP	23824327
MIRT517400	hsa-miR-6758-5p	PAR-CLIP	22012620
MIRT517399	hsa-miR-6856-5p	PAR-CLIP	22012620
MIRT517398	hsa-miR-3125	PAR-CLIP	22012620
MIRT517396	hsa-miR-3916	PAR-CLIP	22012620
MIRT517397	hsa-miR-6859-5p	PAR-CLIP	22012620
MIRT517395	hsa-miR-4476	PAR-CLIP	22012620
MIRT517394	hsa-miR-6876-5p	PAR-CLIP	22012620
MIRT517393	hsa-miR-4533	PAR-CLIP	22012620
MIRT517400	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT517399	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT517398	hsa-miR-3125	PAR-CLIP	23446348
MIRT517396	hsa-miR-3916	PAR-CLIP	23446348
MIRT517397	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT517395	hsa-miR-4476	PAR-CLIP	23446348
MIRT517394	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT517393	hsa-miR-4533	PAR-CLIP	23446348
MIRT821167	hsa-miR-1273f	CLIP-seq
MIRT821168	hsa-miR-1293	CLIP-seq
MIRT821169	hsa-miR-150	CLIP-seq
MIRT821170	hsa-miR-1972	CLIP-seq
MIRT821171	hsa-miR-2278	CLIP-seq
MIRT821172	hsa-miR-326	CLIP-seq
MIRT821173	hsa-miR-330-5p	CLIP-seq
MIRT821174	hsa-miR-4483	CLIP-seq
MIRT821175	hsa-miR-4534	CLIP-seq
MIRT821176	hsa-miR-4687-3p	CLIP-seq
MIRT821177	hsa-miR-4717-5p	CLIP-seq
MIRT821178	hsa-miR-4802-5p	CLIP-seq
MIRT821179	hsa-miR-541	CLIP-seq
MIRT821180	hsa-miR-654-5p	CLIP-seq
MIRT1545734	hsa-miR-101	CLIP-seq
MIRT1545735	hsa-miR-1291	CLIP-seq
MIRT1545736	hsa-miR-296-3p	CLIP-seq
MIRT1545737	hsa-miR-296-5p	CLIP-seq
MIRT1545738	hsa-miR-3122	CLIP-seq
MIRT1545739	hsa-miR-3614-5p	CLIP-seq
MIRT1545740	hsa-miR-3689a-3p	CLIP-seq
MIRT1545741	hsa-miR-3689c	CLIP-seq
MIRT1545742	hsa-miR-3913-5p	CLIP-seq
MIRT1545743	hsa-miR-3940-5p	CLIP-seq
MIRT1545744	hsa-miR-4488	CLIP-seq
MIRT1545745	hsa-miR-4507	CLIP-seq
MIRT1545746	hsa-miR-4645-3p	CLIP-seq
MIRT1545747	hsa-miR-4649-3p	CLIP-seq
MIRT1545748	hsa-miR-4697-5p	CLIP-seq
MIRT1545749	hsa-miR-4728-5p	CLIP-seq
MIRT1545750	hsa-miR-4785	CLIP-seq
MIRT1545751	hsa-miR-488	CLIP-seq
MIRT1545752	hsa-miR-542-5p	CLIP-seq
MIRT1545753	hsa-miR-552	CLIP-seq
MIRT1545754	hsa-miR-629	CLIP-seq
MIRT1556031	hsa-miR-1915	CLIP-seq
MIRT1556032	hsa-miR-2117	CLIP-seq
MIRT1556033	hsa-miR-3117-3p	CLIP-seq
MIRT1556034	hsa-miR-3169	CLIP-seq
MIRT1556035	hsa-miR-3199	CLIP-seq
MIRT1556036	hsa-miR-4273	CLIP-seq
MIRT1556037	hsa-miR-4279	CLIP-seq
MIRT1556038	hsa-miR-4759	CLIP-seq
MIRT1942729	hsa-miR-1281	CLIP-seq
MIRT1545740	hsa-miR-3689a-3p	CLIP-seq
MIRT1545741	hsa-miR-3689c	CLIP-seq
MIRT1942730	hsa-miR-4436b-3p	CLIP-seq
MIRT1545751	hsa-miR-488	CLIP-seq
MIRT821168	hsa-miR-1293	CLIP-seq
MIRT821171	hsa-miR-2278	CLIP-seq
MIRT1545738	hsa-miR-3122	CLIP-seq
MIRT821172	hsa-miR-326	CLIP-seq
MIRT821173	hsa-miR-330-5p	CLIP-seq
MIRT1545739	hsa-miR-3614-5p	CLIP-seq
MIRT1545740	hsa-miR-3689a-3p	CLIP-seq
MIRT1545741	hsa-miR-3689c	CLIP-seq
MIRT1545742	hsa-miR-3913-5p	CLIP-seq
MIRT2181509	hsa-miR-3922-5p	CLIP-seq
MIRT1545743	hsa-miR-3940-5p	CLIP-seq
MIRT1942730	hsa-miR-4436b-3p	CLIP-seq
MIRT2181510	hsa-miR-4447	CLIP-seq
MIRT2181511	hsa-miR-4468	CLIP-seq
MIRT2181512	hsa-miR-4472	CLIP-seq
MIRT821174	hsa-miR-4483	CLIP-seq
MIRT1545745	hsa-miR-4507	CLIP-seq
MIRT821176	hsa-miR-4687-3p	CLIP-seq
MIRT2181513	hsa-miR-4691-3p	CLIP-seq
MIRT2181514	hsa-miR-4708-3p	CLIP-seq
MIRT821179	hsa-miR-541	CLIP-seq
MIRT1545754	hsa-miR-629	CLIP-seq
MIRT821180	hsa-miR-654-5p	CLIP-seq
MIRT2444789	hsa-miR-1909	CLIP-seq
MIRT821171	hsa-miR-2278	CLIP-seq
MIRT2444790	hsa-miR-4660	CLIP-seq
MIRT821176	hsa-miR-4687-3p	CLIP-seq
MIRT2444791	hsa-miR-4688	CLIP-seq
MIRT2444792	hsa-miR-486-3p	CLIP-seq
MIRT821179	hsa-miR-541	CLIP-seq
MIRT821180	hsa-miR-654-5p	CLIP-seq
MIRT2484923	hsa-miR-122	CLIP-seq
MIRT821167	hsa-miR-1273f	CLIP-seq
MIRT2484924	hsa-miR-185	CLIP-seq
MIRT821170	hsa-miR-1972	CLIP-seq
MIRT2484925	hsa-miR-298	CLIP-seq
MIRT2484926	hsa-miR-3714	CLIP-seq
MIRT2484927	hsa-miR-3911	CLIP-seq
MIRT2484928	hsa-miR-3915	CLIP-seq
MIRT2181509	hsa-miR-3922-5p	CLIP-seq
MIRT2484929	hsa-miR-3928	CLIP-seq
MIRT2484930	hsa-miR-4267	CLIP-seq
MIRT2484931	hsa-miR-4274	CLIP-seq
MIRT2484932	hsa-miR-4306	CLIP-seq
MIRT2484933	hsa-miR-4455	CLIP-seq
MIRT2484934	hsa-miR-4475	CLIP-seq
MIRT2484935	hsa-miR-4493	CLIP-seq
MIRT821175	hsa-miR-4534	CLIP-seq
MIRT2484936	hsa-miR-4644	CLIP-seq
MIRT1545747	hsa-miR-4649-3p	CLIP-seq
MIRT821177	hsa-miR-4717-5p	CLIP-seq
MIRT2484937	hsa-miR-4753-5p	CLIP-seq
MIRT2484938	hsa-miR-4786-3p	CLIP-seq
MIRT821178	hsa-miR-4802-5p	CLIP-seq
MIRT1545751	hsa-miR-488	CLIP-seq
MIRT2484923	hsa-miR-122	CLIP-seq
MIRT821167	hsa-miR-1273f	CLIP-seq
MIRT2484924	hsa-miR-185	CLIP-seq
MIRT1556031	hsa-miR-1915	CLIP-seq
MIRT821170	hsa-miR-1972	CLIP-seq
MIRT1556032	hsa-miR-2117	CLIP-seq
MIRT2484925	hsa-miR-298	CLIP-seq
MIRT1556033	hsa-miR-3117-3p	CLIP-seq
MIRT1556034	hsa-miR-3169	CLIP-seq
MIRT1556035	hsa-miR-3199	CLIP-seq
MIRT2484926	hsa-miR-3714	CLIP-seq
MIRT2484927	hsa-miR-3911	CLIP-seq
MIRT2484928	hsa-miR-3915	CLIP-seq
MIRT2181509	hsa-miR-3922-5p	CLIP-seq
MIRT2484929	hsa-miR-3928	CLIP-seq
MIRT2484930	hsa-miR-4267	CLIP-seq
MIRT1556036	hsa-miR-4273	CLIP-seq
MIRT2484931	hsa-miR-4274	CLIP-seq
MIRT1556037	hsa-miR-4279	CLIP-seq
MIRT2484932	hsa-miR-4306	CLIP-seq
MIRT2484933	hsa-miR-4455	CLIP-seq
MIRT2484934	hsa-miR-4475	CLIP-seq
MIRT2484935	hsa-miR-4493	CLIP-seq
MIRT2675962	hsa-miR-4515	CLIP-seq
MIRT821175	hsa-miR-4534	CLIP-seq
MIRT2484936	hsa-miR-4644	CLIP-seq
MIRT1545747	hsa-miR-4649-3p	CLIP-seq
MIRT821177	hsa-miR-4717-5p	CLIP-seq
MIRT2484937	hsa-miR-4753-5p	CLIP-seq
MIRT1556038	hsa-miR-4759	CLIP-seq
MIRT2484938	hsa-miR-4786-3p	CLIP-seq
MIRT821178	hsa-miR-4802-5p	CLIP-seq
MIRT1545751	hsa-miR-488	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	15536164
RELA	Activation	15536164

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0005201	Function	Extracellular matrix structural constituent	NAS	1860845
GO:0005515	Function	Protein binding	IPI	11598131, 32814053
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0009986	Component	Cell surface	IDA	2212616
GO:0019955	Function	Cytokine binding	IEA
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	ISS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 25037231, 27559042, 28327460, 28675934
GO:0030133	Component	Transport vesicle	IDA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28327460, 28675934
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0031012	Component	Extracellular matrix	NAS	1860845
GO:0042383	Component	Sarcolemma	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0050840	Function	Extracellular matrix binding	IEA
GO:0060348	Process	Bone development	IEA
GO:0061975	Process	Articular cartilage development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 301870
• HGNC: 1044
• e!Ensembl: ENSG00000182492

Protein

• UniProt ID: P21810
• Protein name: Biglycan (Bone/cartilage proteoglycan I) (PG-S1)
• Protein function: May be involved in collagen fiber assembly.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	62 → 89	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	90 → 150	Leucine rich repeat	Repeat
  PF13855	LRR_8	229 → 289	Leucine rich repeat	Repeat
  PF13855	LRR_8	159 → 220	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Found in several connective tissues, especially in articular cartilages. {ECO:0000269|PubMed:32337544}.
• Sequence:

  MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYS
  AMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALV
  LVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFS
  GLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNK
  IQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
  LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLA
  IQFGNYKK

• Sequence length: 368

Pathways

KEGG Pathway	Reactome Pathway
Cytoskeleton in muscle cells	A tetrasaccharide linker sequence is required for GAG synthesis
	Chondroitin sulfate biosynthesis
	Dermatan sulfate biosynthesis
	CS/DS degradation
	ECM proteoglycans
	Defective B4GALT7 causes EDS, progeroid type
	Defective B3GAT3 causes JDSSDHD
	Defective CHST3 causes SEDCJD
	Defective CHST14 causes EDS, musculocontractural type
	Defective CHSY1 causes TPBS
	Defective B3GALT6 causes EDSP2 and SEMDJL1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Familial aortopathy	Likely pathogenic	rs2124232156	RCV003226724	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Likely pathogenic	rs886037823	RCV000256226	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meester-Loeys syndrome	Likely pathogenic; Pathogenic	rs1556993331, rs1556992691, rs2124232156, rs886037823, rs2521203628, rs2521227899, rs2521219168, rs1602981441	RCV004552085 RCV002272960 RCV004548503 RCV000412663 RCV004554227 RCV004554228 RCV004554232 RCV004554233 RCV004549861	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
X-linked spondyloepimetaphyseal dysplasia	Likely pathogenic; Pathogenic	rs782199865, rs879255604, rs879255605	RCV002306435 RCV000236799 RCV000235501	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (17)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	28196072, 30573740	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	15292528	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BGN-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	35234341	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular phenotype	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CONTRACTURAL ARACHNODACTYLY	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOEPIMETAPHYSEAL DYSPLASIA, X-LINKED	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	27236923	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
X-LINKED SEVERE SYNDROMIC THORACIC AORTIC ANEURYSM AND DISSECTION	—	Orphanet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (218)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	27034473		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31264215		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15536164		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17660861	Stimulate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	29921372		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	10652025		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	15536164		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27022229		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	27632686	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	9786264	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MFAP5 4 shared diseasesCongenital contractural arachnodactyly, Thoracic aortic aneurysm and aortic dissection, Marfan syndrome, familial thoracic aortic aneurysm and aortic dissection 6 shared evidence sourcesCTD (Congenital contractural arachnodactyly), Disgenet (Thoracic aortic aneurysm and aortic dissection), ClinGen (Thoracic aortic aneurysm and aortic dissection), GenCC (Thoracic aortic aneurysm and aortic dissection), CTD (Marfan syndrome), ClinGen (familial thoracic aortic aneurysm and aortic dissection) Related via 4 shared diseases including Congenital contractural arachnodactyly, Thoracic aortic aneurysm and aortic dissection — evidence mostly CTD. MAT2A 3 shared diseasesThoracic aortic aneurysm and aortic dissection, Marfan syndrome, familial thoracic aortic aneurysm and aortic dissection 5 shared evidence sourcesDisgenet (Thoracic aortic aneurysm and aortic dissection), ClinGen (Thoracic aortic aneurysm and aortic dissection), GenCC (Thoracic aortic aneurysm and aortic dissection), CTD (Marfan syndrome), ClinGen (familial thoracic aortic aneurysm and aortic dissection) Related via 3 shared diseases including Thoracic aortic aneurysm and aortic dissection, Marfan syndrome — evidence mostly ClinGen. NCAN 11 shared pathwaysA tetrasaccharide linker sequence is required for GAG synthesis, Defective B4GALT7 causes EDS, progeroid type, Defective B3GAT3 causes JDSSDHD, Defective B3GALT6 causes EDSP2 and SEMDJL1, Dermatan sulfate biosynthesis, Chondroitin sulfate biosynthesis, CS/DS degradation, Defective CHST3 causes SEDCJD, Defective CHST14 causes EDS, musculocontractural type, Defective CHSY1 causes TPBS, ECM proteoglycans Related via 11 shared pathways including A tetrasaccharide linker sequence is required for GAG synthesis, Defective B4GALT7 causes EDS, progeroid type. BCAN 11 shared pathwaysA tetrasaccharide linker sequence is required for GAG synthesis, Defective B4GALT7 causes EDS, progeroid type, Defective B3GAT3 causes JDSSDHD, Defective B3GALT6 causes EDSP2 and SEMDJL1, Dermatan sulfate biosynthesis, Chondroitin sulfate biosynthesis, CS/DS degradation, Defective CHST3 causes SEDCJD, Defective CHST14 causes EDS, musculocontractural type, Defective CHSY1 causes TPBS, ECM proteoglycans Related via 11 shared pathways including A tetrasaccharide linker sequence is required for GAG synthesis, Defective B4GALT7 causes EDS, progeroid type. CSPG5 10 shared pathwaysA tetrasaccharide linker sequence is required for GAG synthesis, Defective B4GALT7 causes EDS, progeroid type, Defective B3GAT3 causes JDSSDHD, Defective B3GALT6 causes EDSP2 and SEMDJL1, Dermatan sulfate biosynthesis, Chondroitin sulfate biosynthesis, CS/DS degradation, Defective CHST3 causes SEDCJD, Defective CHST14 causes EDS, musculocontractural type, Defective CHSY1 causes TPBS Related via 10 shared pathways including A tetrasaccharide linker sequence is required for GAG synthesis, Defective B4GALT7 causes EDS, progeroid type.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MFAP5	4	["Congenital contractural arachnodactyly","Thoracic aortic aneurysm and aortic dissection","Marfan syndrome","familial thoracic aortic aneurysm and aortic dissection"]	0	[]	6	["CTD (Congenital contractural arachnodactyly)","Disgenet (Thoracic aortic aneurysm and aortic dissection)","ClinGen (Thoracic aortic aneurysm and aortic dissection)","GenCC (Thoracic aortic aneurysm and aortic dissection)","CTD (Marfan syndrome)","ClinGen (familial thoracic aortic aneurysm and aortic dissection)"]
MAT2A	3	["Thoracic aortic aneurysm and aortic dissection","Marfan syndrome","familial thoracic aortic aneurysm and aortic dissection"]	0	[]	5	["Disgenet (Thoracic aortic aneurysm and aortic dissection)","ClinGen (Thoracic aortic aneurysm and aortic dissection)","GenCC (Thoracic aortic aneurysm and aortic dissection)","CTD (Marfan syndrome)","ClinGen (familial thoracic aortic aneurysm and aortic dissection)"]
NCAN	0	[]	11	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS","ECM proteoglycans"]	0	[]
BCAN	0	[]	11	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS","ECM proteoglycans"]	0	[]
CSPG5	0	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 2 of 5 related genesMFAP5, NCAN Schizophrenia Linked via 2 of 5 related genesNCAN, CSPG5 Aortic aneurysm Linked via 1 of 5 related genesMFAP5 Cataract Linked via 1 of 5 related genesMFAP5 Connective tissue disease Linked via 1 of 5 related genesMFAP5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	2	["MFAP5","NCAN"]
Schizophrenia	2	["NCAN","CSPG5"]
Aortic aneurysm	1	["MFAP5"]
Cataract	1	["MFAP5"]
Connective tissue disease	1	["MFAP5"]