BEX5 (brain expressed X-linked 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 340542
Gene name Brain expressed X-linked 5
Gene symbol BEX5
Synonyms (NCBI Gene)
NGFRAP1L1
Chromosome X
Chromosome location Xq22.1
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018100 hsa-miR-335-5p Microarray 18185580
MIRT821120 hsa-miR-4698 CLIP-seq
MIRT821121 hsa-miR-600 CLIP-seq
MIRT821122 hsa-miR-1290 CLIP-seq
MIRT821122 hsa-miR-1290 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005515 Function Protein binding IPI 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0007165 Process Signal transduction IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300693 27990 ENSG00000184515
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5H9J7
Protein name Protein BEX5 (Brain-expressed X-linked protein 5) (NGFRAP1-like protein 1) (Nerve growth factor receptor-associated protein 2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04538 BEX 1 → 107 Brain expressed X-linked like family Family
Sequence 
MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDM
IDGDGDDMERFMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMP
Sequence length 111
Interactions View interactions

No strongly related genes found yet for BEX5.

No additional diseases found yet through genes similar to BEX5.