BEX2 (brain expressed X-linked 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 84707
• Gene name: Brain expressed X-linked 2
• Gene symbol: BEX2
• Synonyms (NCBI Gene): BEX1, DJ79P11.1
• Chromosome: X
• Chromosome location: Xq22.2
• Summary: This gene belongs to the brain expressed X-linked gene family. The encoded protein interacts with the transcription factor LIM domain only 2 in a DNA-binding complex that recognizes the E-box element and promotes transcription. This gene has been found to

miRNA Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018397	hsa-miR-335-5p	Microarray	18185580
MIRT047027	hsa-miR-204-5p	CLASH	23622248
MIRT047027	hsa-miR-204-5p	CLASH	23622248
MIRT821115	hsa-miR-3124-3p	CLIP-seq
MIRT821116	hsa-miR-548a-3p	CLIP-seq
MIRT821117	hsa-miR-548e	CLIP-seq
MIRT821118	hsa-miR-548f	CLIP-seq
MIRT821119	hsa-miR-587	CLIP-seq
MIRT2484787	hsa-miR-1323	CLIP-seq
MIRT2484788	hsa-miR-181a	CLIP-seq
MIRT2484789	hsa-miR-181b	CLIP-seq
MIRT2484790	hsa-miR-181c	CLIP-seq
MIRT2484791	hsa-miR-181d	CLIP-seq
MIRT2484792	hsa-miR-1909	CLIP-seq
MIRT2484793	hsa-miR-320e	CLIP-seq
MIRT2484794	hsa-miR-3613-3p	CLIP-seq
MIRT2484795	hsa-miR-4262	CLIP-seq
MIRT2484796	hsa-miR-4476	CLIP-seq
MIRT2484797	hsa-miR-4490	CLIP-seq
MIRT2484798	hsa-miR-4719	CLIP-seq
MIRT2484799	hsa-miR-4729	CLIP-seq
MIRT2484800	hsa-miR-520d-5p	CLIP-seq
MIRT2484801	hsa-miR-524-5p	CLIP-seq
MIRT2484802	hsa-miR-543	CLIP-seq
MIRT2484803	hsa-miR-548m	CLIP-seq
MIRT2484804	hsa-miR-548o	CLIP-seq
MIRT2484805	hsa-miR-579	CLIP-seq
MIRT2484806	hsa-miR-651	CLIP-seq
MIRT2484807	hsa-miR-664	CLIP-seq
MIRT2484788	hsa-miR-181a	CLIP-seq
MIRT2484789	hsa-miR-181b	CLIP-seq
MIRT2484790	hsa-miR-181c	CLIP-seq
MIRT2484791	hsa-miR-181d	CLIP-seq
MIRT2484794	hsa-miR-3613-3p	CLIP-seq
MIRT2484795	hsa-miR-4262	CLIP-seq
MIRT2484799	hsa-miR-4729	CLIP-seq
MIRT2484800	hsa-miR-520d-5p	CLIP-seq
MIRT2484801	hsa-miR-524-5p	CLIP-seq
MIRT2484802	hsa-miR-543	CLIP-seq
MIRT2484805	hsa-miR-579	CLIP-seq
MIRT2484807	hsa-miR-664	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Activation	21384344

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0042981	Process	Regulation of apoptotic process	IDA	19711341
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	19711341
GO:0140678	Function	Molecular function inhibitor activity	ISS

Other IDs

• MIM: 300691
• HGNC: 30933
• e!Ensembl: ENSG00000133134

Protein

• UniProt ID: Q9BXY8
• Protein name: Protein BEX2 (Brain-expressed X-linked protein 2) (hBex2)
• Protein function: Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer (PubMed:19711341). Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04538	BEX	14 → 124	Brain expressed X-linked like family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Widely expressed in breast cancer cell lines. {ECO:0000269|PubMed:15958283, ECO:0000269|PubMed:19711341}.
• Sequence:

  MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQ
  PILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDH
  HDEFCLMP

• Sequence length: 128

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Abnormality of neuronal migration	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (42)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31612060		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	19412433, 30779920		★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29572119		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19711341, 20482821, 21384344, 22907646, 28367093, 30779920		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20482821	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18827820	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21551254	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29192139		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	19412433, 30779920		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33299012	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28367093, 30779920		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32119177	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29192139		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	24333734		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21211035	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24390962, 28367093, 30779920		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21211035, 24390962, 28367093, 30779920		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19412433, 22907646, 23022184, 24390962, 30779920		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29192139		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29192139		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17251904, 19028701		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19835597	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26046670		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24209690, 29029472, 30779920, 31530937		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37777549	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37777549	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16818640		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19711341, 20482821, 21384344, 22907646, 28367093, 30779920		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19412433, 26296882, 30779920		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17638883		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19711341, 20482821, 21384344		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16818640, 21211035, 23362108, 24333734, 26046670, 28367093, 30132532		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	19412433, 30779920		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	39318189, 39385481	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23782156	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23362108		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30132532		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	26296882		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	19412433, 30779920		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for BEX2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BEX2.