BEX1 (brain expressed X-linked 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 55859
• Gene name: Brain expressed X-linked 1
• Gene symbol: BEX1
• Synonyms (NCBI Gene): BEX2, HBEX2, HGR74-h
• Chromosome: X
• Chromosome location: Xq22.1|Xq22

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022761	hsa-miR-124-3p	Microarray	18668037
MIRT030491	hsa-miR-24-3p	Microarray	19748357
MIRT046447	hsa-miR-15b-5p	CLASH	23622248
MIRT821107	hsa-miR-3124-3p	CLIP-seq
MIRT821108	hsa-miR-3613-3p	CLIP-seq
MIRT821109	hsa-miR-4282	CLIP-seq
MIRT821110	hsa-miR-4463	CLIP-seq
MIRT821111	hsa-miR-4494	CLIP-seq
MIRT821112	hsa-miR-4495	CLIP-seq
MIRT821113	hsa-miR-587	CLIP-seq
MIRT821114	hsa-miR-600	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001223	Function	Transcription coactivator binding	IPI	16314316
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IDA	16314316
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS
GO:0035591	Function	Signaling adaptor activity	IDA	16314316
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16314316
GO:0046872	Function	Metal ion binding	IEA
GO:0140678	Function	Molecular function inhibitor activity	ISS

Other IDs

• MIM: 300690
• HGNC: 1036
• e!Ensembl: ENSG00000133169

Protein

• UniProt ID: Q9HBH7
• Protein name: Protein BEX1 (Brain-expressed X-linked protein 1)
• Protein function: Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cyc
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04538	BEX	14 → 121	Brain expressed X-linked like family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Expressed in lung, skeletal muscle, peripheral blood leukocyte, stomach, lymph node, trachea and bone marrow. Highly expressed in acute my
• Sequence:

  MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPIL
  QYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDE
  FCLMP

• Sequence length: 125

Related Genes

No strongly related genes found yet for BEX1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BEX1.