BEST4 (bestrophin 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 266675
• Gene name: Bestrophin 4
• Gene symbol: BEST4
• Synonyms (NCBI Gene): VMD2L2
• Chromosome: 1
• Chromosome location: 1p34.1
• Summary: This gene is a member of the bestrophin gene family of anion channels. Bestrophin genes share a similar gene structure with highly conserved exon-intron boundaries, but with distinct 3` ends. Bestrophins are transmembrane proteins that contain a homologou

miRNA Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT820963	hsa-miR-30a	CLIP-seq
MIRT820964	hsa-miR-30b	CLIP-seq
MIRT820965	hsa-miR-30c	CLIP-seq
MIRT820966	hsa-miR-30d	CLIP-seq
MIRT820967	hsa-miR-30e	CLIP-seq
MIRT820968	hsa-miR-3143	CLIP-seq
MIRT820969	hsa-miR-4495	CLIP-seq
MIRT820970	hsa-miR-513c	CLIP-seq
MIRT820971	hsa-miR-514b-5p	CLIP-seq
MIRT820972	hsa-miR-548ae	CLIP-seq
MIRT820973	hsa-miR-548aj	CLIP-seq
MIRT820974	hsa-miR-548am	CLIP-seq
MIRT820975	hsa-miR-548x	CLIP-seq
MIRT1942629	hsa-miR-1343	CLIP-seq
MIRT1942630	hsa-miR-3690	CLIP-seq
MIRT1942631	hsa-miR-4254	CLIP-seq
MIRT2181413	hsa-miR-1292	CLIP-seq
MIRT1942629	hsa-miR-1343	CLIP-seq
MIRT2181414	hsa-miR-15a	CLIP-seq
MIRT2181415	hsa-miR-15b	CLIP-seq
MIRT2181416	hsa-miR-16	CLIP-seq
MIRT2181417	hsa-miR-195	CLIP-seq
MIRT2181418	hsa-miR-3074-5p	CLIP-seq
MIRT2181419	hsa-miR-3622a-3p	CLIP-seq
MIRT2181420	hsa-miR-3622b-3p	CLIP-seq
MIRT1942630	hsa-miR-3690	CLIP-seq
MIRT2181421	hsa-miR-424	CLIP-seq
MIRT1942631	hsa-miR-4254	CLIP-seq
MIRT2181422	hsa-miR-4471	CLIP-seq
MIRT2181423	hsa-miR-4638-3p	CLIP-seq
MIRT2181424	hsa-miR-4646-5p	CLIP-seq
MIRT2181425	hsa-miR-497	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005229	Function	Intracellularly calcium-gated chloride channel activity	IDA	12907679
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	IDA	18400985
GO:0005254	Function	Chloride channel activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0015267	Function	Channel activity	IEA
GO:0015701	Process	Bicarbonate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0160133	Function	Bicarbonate channel activity	IDA	18400985
GO:1902476	Process	Chloride transmembrane transport	IBA

Other IDs

• MIM: 607336
• HGNC: 17106
• e!Ensembl: ENSG00000142959

Protein

• UniProt ID: Q8NFU0
• Protein name: Bestrophin-4 (Vitelliform macular dystrophy 2-like protein 2)
• Protein function: Ligand-gated anion channel that allows the movement of anions across cell membranes when activated by Calcium (Ca2+) (PubMed:12907679, PubMed:18400985). Mediates the movement of hydrogencarbonate and chloride (PubMed:12907679, PubMed:18400985).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01062	Bestrophin	8 → 331	Bestrophin, RFP-TM, chloride channel	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly found in colon and the weakly in fetal brain, spinal cord, retina, lung, trachea, testis and placenta. {ECO:0000269|PubMed:12032738}.
• Sequence:

  MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITYRLLLTQEQRY
  VYAQVARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQR
  GRLLRRTLIRYANLASVLVLRSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDFNK
  YWVPCVWFTNLAAQARRDGRIRDDIALCLLLEELNKYRAKCSMLFHYDWISIPLVYTQVV
  TIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDMYVPLTTLLQFFFYA
  GWLKVAEQIINPFGEDDDDFETNQLIDRNLQVSLLSVDEMYQNLPPAEKDQYWDEDQPQP
  PYTVATAAESLRPSFLGSTFNLRMSDDPEQSLQVEASPGSGRPAPAAQTPLLGRFLGVGA
  PSPAISLRNFGRVRGTPRPPHLLRFRAEEGGDPEAAARIEEESAESGDEALEP

• Sequence length: 473

Pathways

Reactome Pathway:

Stimuli-sensing channels

Related Genes

No strongly related genes found yet for BEST4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BEST4.