Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	441925
Gene name	Beclin 2
Gene symbol	BECN2
Synonyms (NCBI Gene)	BECN1L1BECN1P1
Chromosome	1
Chromosome location	1q43

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000407	Component	Phagophore assembly site	IBA
GO:0000423	Process	Mitophagy	IBA
GO:0005515	Function	Protein binding	IPI	23954414
GO:0005737	Component	Cytoplasm	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IMP	23954414
GO:0006914	Process	Autophagy	IMP	23954414
GO:0006995	Process	Cellular response to nitrogen starvation	IBA
GO:0008333	Process	Endosome to lysosome transport	IEA
GO:0008333	Process	Endosome to lysosome transport	IMP	23954414
GO:0008333	Process	Endosome to lysosome transport	IMP	23954414
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0032801	Process	Receptor catabolic process	IEA
GO:0034271	Component	Phosphatidylinositol 3-kinase complex, class III, type I	IBA
GO:0034272	Component	Phosphatidylinositol 3-kinase complex, class III, type II	IBA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IBA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045324	Process	Late endosome to vacuole transport	IBA
GO:1990172	Process	G protein-coupled receptor catabolic process	IEA
GO:1990172	Process	G protein-coupled receptor catabolic process	IMP	23954414
GO:1990172	Process	G protein-coupled receptor catabolic process	IPI	23954414

MIM	HGNC	e!Ensembl
615687	38606	ENSG00000196289

A8MW95

Protein name

Beclin-2 (Beclin-1 autophagy-related pseudogene 1) (Beclin-1-like protein 1)

Protein function

Involved in 2 distinct lysosomal degradation pathways: acts as a regulator of autophagy and as a regulator of G-protein coupled receptors turnover. Regulates degradation in lysosomes of a variety of G-protein coupled receptors via its interactio

PDB

5K7B , 5K9L , 8GT9 , 8GU7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04111	APG6	246 → 427	Apg6 BARA domain	Domain
PF17675	APG6_N	116 → 243	Apg6 coiled-coil region	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Present in fetal and adult brain (at protein level). {ECO:0000269|PubMed:23954414}.

Sequence

MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD
GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE
CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL
EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR
VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA
NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ
FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW
SLIWVASRYQK

Sequence length

431

Interactions

View interactions

KEGG Pathway
Autophagy - other
Mitophagy - animal
Autophagy - animal
Apoptosis - multiple species
Apelin signaling pathway
Alzheimer disease
Amyotrophic lateral sclerosis
Huntington disease
Spinocerebellar ataxia
Pathways of neurodegeneration - multiple diseases
Shigellosis
Kaposi sarcoma-associated herpesvirus infection

BECN2 (beclin 2)

Bookmark This Gene