Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	56898
Gene name	3-hydroxybutyrate dehydrogenase 2
Gene symbol	BDH2
Synonyms (NCBI Gene)	DHRS6EFA6RPRO20933SDR15C1UCPA-ORUNQ6308
Chromosome	4
Chromosome location	4q24

206 Show/Hide all (206)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004219	hsa-miR-346	Microarray	16822819
MIRT019992	hsa-miR-375	Microarray	20215506
MIRT031043	hsa-miR-21-5p	Microarray	20048743
MIRT039022	hsa-miR-766-3p	CLASH	23622248
MIRT820434	hsa-miR-1182	CLIP-seq
MIRT820435	hsa-miR-1184	CLIP-seq
MIRT820436	hsa-miR-1297	CLIP-seq
MIRT820437	hsa-miR-138	CLIP-seq
MIRT820438	hsa-miR-1587	CLIP-seq
MIRT820439	hsa-miR-193a-5p	CLIP-seq
MIRT820440	hsa-miR-26a	CLIP-seq
MIRT820441	hsa-miR-26b	CLIP-seq
MIRT820442	hsa-miR-3140-5p	CLIP-seq
MIRT820443	hsa-miR-331-5p	CLIP-seq
MIRT820444	hsa-miR-371-5p	CLIP-seq
MIRT820445	hsa-miR-4418	CLIP-seq
MIRT820446	hsa-miR-4437	CLIP-seq
MIRT820447	hsa-miR-4465	CLIP-seq
MIRT820448	hsa-miR-4539	CLIP-seq
MIRT820449	hsa-miR-4674	CLIP-seq
MIRT820450	hsa-miR-4680-5p	CLIP-seq
MIRT820451	hsa-miR-4722-3p	CLIP-seq
MIRT820452	hsa-miR-4795-3p	CLIP-seq
MIRT820453	hsa-miR-509-3-5p	CLIP-seq
MIRT820454	hsa-miR-509-5p	CLIP-seq
MIRT820455	hsa-miR-635	CLIP-seq
MIRT820435	hsa-miR-1184	CLIP-seq
MIRT1942441	hsa-miR-122	CLIP-seq
MIRT1942442	hsa-miR-3620	CLIP-seq
MIRT1942443	hsa-miR-3622b-5p	CLIP-seq
MIRT820444	hsa-miR-371-5p	CLIP-seq
MIRT1942444	hsa-miR-4254	CLIP-seq
MIRT1942445	hsa-miR-4308	CLIP-seq
MIRT820445	hsa-miR-4418	CLIP-seq
MIRT820453	hsa-miR-509-3-5p	CLIP-seq
MIRT820454	hsa-miR-509-5p	CLIP-seq
MIRT2181166	hsa-miR-106a	CLIP-seq
MIRT2181167	hsa-miR-106b	CLIP-seq
MIRT820435	hsa-miR-1184	CLIP-seq
MIRT1942441	hsa-miR-122	CLIP-seq
MIRT2181168	hsa-miR-1245	CLIP-seq
MIRT820436	hsa-miR-1297	CLIP-seq
MIRT2181169	hsa-miR-150	CLIP-seq
MIRT820438	hsa-miR-1587	CLIP-seq
MIRT2181170	hsa-miR-15a	CLIP-seq
MIRT2181171	hsa-miR-15b	CLIP-seq
MIRT2181172	hsa-miR-16	CLIP-seq
MIRT2181173	hsa-miR-17	CLIP-seq
MIRT2181174	hsa-miR-195	CLIP-seq
MIRT2181175	hsa-miR-1976	CLIP-seq
MIRT2181176	hsa-miR-20a	CLIP-seq
MIRT2181177	hsa-miR-20b	CLIP-seq
MIRT820440	hsa-miR-26a	CLIP-seq
MIRT820441	hsa-miR-26b	CLIP-seq
MIRT2181178	hsa-miR-298	CLIP-seq
MIRT2181179	hsa-miR-3151	CLIP-seq
MIRT2181180	hsa-miR-3159	CLIP-seq
MIRT2181181	hsa-miR-34b	CLIP-seq
MIRT2181182	hsa-miR-3591-5p	CLIP-seq
MIRT2181183	hsa-miR-3609	CLIP-seq
MIRT1942443	hsa-miR-3622b-5p	CLIP-seq
MIRT2181184	hsa-miR-3689d	CLIP-seq
MIRT820444	hsa-miR-371-5p	CLIP-seq
MIRT2181185	hsa-miR-424	CLIP-seq
MIRT2181186	hsa-miR-4266	CLIP-seq
MIRT2181187	hsa-miR-4290	CLIP-seq
MIRT2181188	hsa-miR-4312	CLIP-seq
MIRT820445	hsa-miR-4418	CLIP-seq
MIRT820446	hsa-miR-4437	CLIP-seq
MIRT2181189	hsa-miR-4461	CLIP-seq
MIRT820447	hsa-miR-4465	CLIP-seq
MIRT2181190	hsa-miR-4524	CLIP-seq
MIRT820449	hsa-miR-4674	CLIP-seq
MIRT2181191	hsa-miR-4690-3p	CLIP-seq
MIRT2181192	hsa-miR-4695-5p	CLIP-seq
MIRT820451	hsa-miR-4722-3p	CLIP-seq
MIRT2181193	hsa-miR-4729	CLIP-seq
MIRT2181194	hsa-miR-4757-5p	CLIP-seq
MIRT2181195	hsa-miR-4779	CLIP-seq
MIRT2181196	hsa-miR-497	CLIP-seq
MIRT2181197	hsa-miR-503	CLIP-seq
MIRT820453	hsa-miR-509-3-5p	CLIP-seq
MIRT820454	hsa-miR-509-5p	CLIP-seq
MIRT2181198	hsa-miR-519a	CLIP-seq
MIRT2181199	hsa-miR-519b-3p	CLIP-seq
MIRT2181200	hsa-miR-519c-3p	CLIP-seq
MIRT2181201	hsa-miR-519d	CLIP-seq
MIRT2181202	hsa-miR-520g	CLIP-seq
MIRT2181203	hsa-miR-520h	CLIP-seq
MIRT2181204	hsa-miR-548ah	CLIP-seq
MIRT820455	hsa-miR-635	CLIP-seq
MIRT2181205	hsa-miR-646	CLIP-seq
MIRT2181206	hsa-miR-93	CLIP-seq
MIRT820435	hsa-miR-1184	CLIP-seq
MIRT1942441	hsa-miR-122	CLIP-seq
MIRT2484461	hsa-miR-1276	CLIP-seq
MIRT2484462	hsa-miR-1295	CLIP-seq
MIRT820436	hsa-miR-1297	CLIP-seq
MIRT820437	hsa-miR-138	CLIP-seq
MIRT820438	hsa-miR-1587	CLIP-seq
MIRT2181175	hsa-miR-1976	CLIP-seq
MIRT2484463	hsa-miR-21	CLIP-seq
MIRT820440	hsa-miR-26a	CLIP-seq
MIRT820441	hsa-miR-26b	CLIP-seq
MIRT2484464	hsa-miR-3122	CLIP-seq
MIRT820442	hsa-miR-3140-5p	CLIP-seq
MIRT2181179	hsa-miR-3151	CLIP-seq
MIRT2484465	hsa-miR-323-3p	CLIP-seq
MIRT2484466	hsa-miR-338-5p	CLIP-seq
MIRT2484467	hsa-miR-3617	CLIP-seq
MIRT1942442	hsa-miR-3620	CLIP-seq
MIRT1942443	hsa-miR-3622b-5p	CLIP-seq
MIRT2484468	hsa-miR-3671	CLIP-seq
MIRT2484469	hsa-miR-3689a-3p	CLIP-seq
MIRT2484470	hsa-miR-3689c	CLIP-seq
MIRT2181184	hsa-miR-3689d	CLIP-seq
MIRT2484471	hsa-miR-370	CLIP-seq
MIRT2484472	hsa-miR-371-3p	CLIP-seq
MIRT820444	hsa-miR-371-5p	CLIP-seq
MIRT2484473	hsa-miR-371b-3p	CLIP-seq
MIRT2484474	hsa-miR-384	CLIP-seq
MIRT2484475	hsa-miR-3913-3p	CLIP-seq
MIRT2484476	hsa-miR-3913-5p	CLIP-seq
MIRT1942444	hsa-miR-4254	CLIP-seq
MIRT2181186	hsa-miR-4266	CLIP-seq
MIRT2484477	hsa-miR-4279	CLIP-seq
MIRT2181187	hsa-miR-4290	CLIP-seq
MIRT1942445	hsa-miR-4308	CLIP-seq
MIRT2484478	hsa-miR-4317	CLIP-seq
MIRT2484479	hsa-miR-4325	CLIP-seq
MIRT820445	hsa-miR-4418	CLIP-seq
MIRT820446	hsa-miR-4437	CLIP-seq
MIRT820447	hsa-miR-4465	CLIP-seq
MIRT820448	hsa-miR-4539	CLIP-seq
MIRT2484480	hsa-miR-4641	CLIP-seq
MIRT820449	hsa-miR-4674	CLIP-seq
MIRT820450	hsa-miR-4680-5p	CLIP-seq
MIRT2181192	hsa-miR-4695-5p	CLIP-seq
MIRT820451	hsa-miR-4722-3p	CLIP-seq
MIRT2484481	hsa-miR-4728-5p	CLIP-seq
MIRT2484482	hsa-miR-4747-3p	CLIP-seq
MIRT2181195	hsa-miR-4779	CLIP-seq
MIRT2484483	hsa-miR-489	CLIP-seq
MIRT2484484	hsa-miR-495	CLIP-seq
MIRT2484485	hsa-miR-500a	CLIP-seq
MIRT820453	hsa-miR-509-3-5p	CLIP-seq
MIRT820454	hsa-miR-509-5p	CLIP-seq
MIRT2484486	hsa-miR-515-3p	CLIP-seq
MIRT2484487	hsa-miR-519e	CLIP-seq
MIRT2484488	hsa-miR-548ac	CLIP-seq
MIRT2484489	hsa-miR-548ae	CLIP-seq
MIRT2484490	hsa-miR-548aj	CLIP-seq
MIRT2484491	hsa-miR-548am	CLIP-seq
MIRT2484492	hsa-miR-548d-3p	CLIP-seq
MIRT2484493	hsa-miR-548x	CLIP-seq
MIRT2484494	hsa-miR-548z	CLIP-seq
MIRT2484495	hsa-miR-590-5p	CLIP-seq
MIRT820455	hsa-miR-635	CLIP-seq
MIRT2484496	hsa-miR-641	CLIP-seq
MIRT820435	hsa-miR-1184	CLIP-seq
MIRT1942441	hsa-miR-122	CLIP-seq
MIRT2181168	hsa-miR-1245	CLIP-seq
MIRT2484461	hsa-miR-1276	CLIP-seq
MIRT2484462	hsa-miR-1295	CLIP-seq
MIRT820436	hsa-miR-1297	CLIP-seq
MIRT820437	hsa-miR-138	CLIP-seq
MIRT820438	hsa-miR-1587	CLIP-seq
MIRT2181175	hsa-miR-1976	CLIP-seq
MIRT2484463	hsa-miR-21	CLIP-seq
MIRT820440	hsa-miR-26a	CLIP-seq
MIRT820441	hsa-miR-26b	CLIP-seq
MIRT2484464	hsa-miR-3122	CLIP-seq
MIRT820442	hsa-miR-3140-5p	CLIP-seq
MIRT2181179	hsa-miR-3151	CLIP-seq
MIRT2484466	hsa-miR-338-5p	CLIP-seq
MIRT2484467	hsa-miR-3617	CLIP-seq
MIRT1942442	hsa-miR-3620	CLIP-seq
MIRT1942443	hsa-miR-3622b-5p	CLIP-seq
MIRT2484469	hsa-miR-3689a-3p	CLIP-seq
MIRT2484470	hsa-miR-3689c	CLIP-seq
MIRT2181184	hsa-miR-3689d	CLIP-seq
MIRT820444	hsa-miR-371-5p	CLIP-seq
MIRT2484475	hsa-miR-3913-3p	CLIP-seq
MIRT2484476	hsa-miR-3913-5p	CLIP-seq
MIRT1942444	hsa-miR-4254	CLIP-seq
MIRT2181186	hsa-miR-4266	CLIP-seq
MIRT1942445	hsa-miR-4308	CLIP-seq
MIRT820445	hsa-miR-4418	CLIP-seq
MIRT820446	hsa-miR-4437	CLIP-seq
MIRT820447	hsa-miR-4465	CLIP-seq
MIRT820448	hsa-miR-4539	CLIP-seq
MIRT2484480	hsa-miR-4641	CLIP-seq
MIRT820449	hsa-miR-4674	CLIP-seq
MIRT820450	hsa-miR-4680-5p	CLIP-seq
MIRT2181192	hsa-miR-4695-5p	CLIP-seq
MIRT820451	hsa-miR-4722-3p	CLIP-seq
MIRT2484481	hsa-miR-4728-5p	CLIP-seq
MIRT2484482	hsa-miR-4747-3p	CLIP-seq
MIRT2181195	hsa-miR-4779	CLIP-seq
MIRT2484484	hsa-miR-495	CLIP-seq
MIRT2484485	hsa-miR-500a	CLIP-seq
MIRT820453	hsa-miR-509-3-5p	CLIP-seq
MIRT820454	hsa-miR-509-5p	CLIP-seq
MIRT2484495	hsa-miR-590-5p	CLIP-seq
MIRT820455	hsa-miR-635	CLIP-seq
MIRT2484496	hsa-miR-641	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003858	Function	3-hydroxybutyrate dehydrogenase activity	IBA
GO:0003858	Function	3-hydroxybutyrate dehydrogenase activity	IDA	16380372
GO:0003858	Function	3-hydroxybutyrate dehydrogenase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16380372
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	16380372
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006635	Process	Fatty acid beta-oxidation	IDA	16380372
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016617	Function	4-oxoproline reductase activity	IEA
GO:0016628	Function	Oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor	IEA
GO:0016628	Function	Oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor	ISS
GO:0019290	Process	Siderophore biosynthetic process	IBA
GO:0019290	Process	Siderophore biosynthetic process	IEA
GO:0019290	Process	Siderophore biosynthetic process	ISS
GO:0030855	Process	Epithelial cell differentiation	IDA	21492153
GO:0042168	Process	Heme metabolic process	ISS
GO:0051287	Function	NAD binding	IDA	16380372
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BUT1

Protein name

Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.-) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (EC 1.1.1.30) (4-oxo-L-proline reductase) (EC 1.1.1.104) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase

Protein function

NAD(H)-dependent dehydrogenase/reductase with a preference for cyclic substrates (By similarity) (PubMed:35150746). Catalyzes stereoselective conversion of 4-oxo-L-proline to cis-4-hydroxy-L-proline, likely a detoxification mechanism for ketopro

PDB

2AG5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	13 → 244		Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in liver (at protein level). {ECO:0000269|PubMed:22527885}.

Sequence

MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID
GGWSL

Sequence length

245

Interactions

View interactions

Reactome Pathway
Synthesis of Ketone Bodies

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (26)
Alzheimer Disease	Alzheimer disease	Pubtator	36776048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16865689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25468909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16270321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26799587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26799587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16865689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	24777603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	BEFREE	24777603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32344823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23941109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31333791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29113828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29113828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29113828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29113828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25468909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26799587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16270321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32344823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31819181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16270321, 26799587, 31333791, 31819181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	16270321		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16270321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16270321	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30643007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with BDH2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for BDH2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to BDH2 (see Related Genes above), that are NOT already directly curated for BDH2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to BDH2.

BDH2 (3-hydroxybutyrate dehydrogenase 2)

Save This Analysis