Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Entrez ID 55024
Gene name B cell scaffold protein with ankyrin repeats 1
Gene symbol BANK1
Synonyms (NCBI Gene)
BANK
Chromosome 4
Chromosome location 4q24
Summary The protein encoded by this gene is a B-cell-specific scaffold protein that functions in B-cell receptor-induced calcium mobilization from intracellular stores. This protein can also promote Lyn-mediated tyrosine phosphorylation of inositol 1,4,5-trisphos
miRNA miRNA information provided by mirtarbase database.
322 Show/Hide all (322)
miRTarBase ID miRNA Experiments Reference
MIRT452491 hsa-miR-6768-3p HITS-CLIP 21572407
MIRT452489 hsa-miR-4662a-5p HITS-CLIP 21572407
MIRT452488 hsa-miR-7641 HITS-CLIP 21572407
MIRT452491 hsa-miR-6768-3p HITS-CLIP 23313552
MIRT452490 hsa-miR-590-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27 Show/Hide all (27)
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IEA
GO:0002020 Function Protease binding IPI 23555801
GO:0002682 Process Regulation of immune system process IEA
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IPI 11782428, 23555801
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610292 18233 ENSG00000153064
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NDB2
Protein name B-cell scaffold protein with ankyrin repeats
Protein function Involved in B-cell receptor (BCR)-induced Ca(2+) mobilization from intracellular stores. Promotes Lyn-mediated phosphorylation of IP3 receptors 1 and 2.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14545 DBB 199 → 328 Dof, BCAP, and BANK (DBB) motif, Domain
PF18567 TIR_3 28 → 154 Toll/interleukin-1 receptor domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in B-cell but not T-cell or myeloid cell lines. Highest expression in CD19(+) B-cells, with very low expression in other cell populations. {ECO:0000269|PubMed:11782428, ECO:0000269|PubMed:18204447}.
Sequence
MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLY
RLENFSFRHLELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKS
SDQLYELLNISQSRWEISTEQEPEDYISVIQSII
FKDSEDYFEVNIPTDLRAKHSGEISE
RKEIEELSEASRNTIPLAVVLPTEIPCENPGEIFIILRDEVIGDTVEVEFTSSNKRIRTR
PALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLC
QNSIEELDGVLTSIFKHEIPYYEFQSLQ
TEICSQNKYTHFKELPTLLHCAAKFGLKNLAI
HLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESS
EDQYDDLYVFIPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQME
RSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKK
TGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRAR
IESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEKFKHWQMGKSGLEMIQQEKLR
QLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPARPQVEKEFGFC
CKKDH
Sequence length 785
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
KEGG Pathway
B cell receptor signaling pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
41
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (41)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 26830138, 33654092
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA — GWAS catalog 24236485
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS — GWAS catalog 26974007
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA — GWAS catalog 31835028
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (55)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ankylosing spondylitis Ankylosing Spondylitis GWASCAT_DG 26974007
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Arthritis Arthritis BEFREE 23065315, 29370826
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 19180476, 28925718 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 22003931, 23065315, 23899688, 28466820, 30016332
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases of the Nervous System Autoimmune nervous system disorder Pubtator 30096841 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular Diseases GWASCAT_DG 30595370
★★★★★
★☆☆☆☆
Found in Text Mining only
Cholangitis, Sclerosing Cholangitis GWASCAT_DG 26974007
★★★★★
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia GWASCAT_DG 26956414, 28165464
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Crohn Disease Crohn Disease GWASDB_DG 23128233
★★★★★
★☆☆☆☆
Found in Text Mining only
Crohn Disease Crohn Disease GWASCAT_DG 23128233, 26192919, 26974007, 28067908
★★★★★
★☆☆☆☆
Found in Text Mining only