BANF1 (barrier to autointegration nuclear assembly factor 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8815
• Gene name: Barrier to autointegration nuclear assembly factor 1
• Gene symbol: BANF1
• Synonyms (NCBI Gene): BAF, BCRP1, D14S1460, NGPS
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both

miRNA Show/Hide all (243)

miRTarBase ID	miRNA	Experiments	Reference
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815730	hsa-miR-1255a	CLIP-seq
MIRT815731	hsa-miR-1255b	CLIP-seq
MIRT815732	hsa-miR-1289	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815734	hsa-miR-2114	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815736	hsa-miR-3125	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815740	hsa-miR-3162-3p	CLIP-seq
MIRT815741	hsa-miR-3175	CLIP-seq
MIRT815742	hsa-miR-320a	CLIP-seq
MIRT815743	hsa-miR-320b	CLIP-seq
MIRT815744	hsa-miR-320c	CLIP-seq
MIRT815745	hsa-miR-320d	CLIP-seq
MIRT815746	hsa-miR-320e	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815749	hsa-miR-3616-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT815751	hsa-miR-3675-5p	CLIP-seq
MIRT815752	hsa-miR-3916	CLIP-seq
MIRT815753	hsa-miR-4278	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815755	hsa-miR-4429	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815759	hsa-miR-4490	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815761	hsa-miR-4638-5p	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815764	hsa-miR-4721	CLIP-seq
MIRT815765	hsa-miR-4727-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815767	hsa-miR-4769-3p	CLIP-seq
MIRT815768	hsa-miR-4782-5p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815772	hsa-miR-765	CLIP-seq
MIRT815773	hsa-miR-873	CLIP-seq
MIRT815774	hsa-miR-877	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815730	hsa-miR-1255a	CLIP-seq
MIRT815731	hsa-miR-1255b	CLIP-seq
MIRT815732	hsa-miR-1289	CLIP-seq
MIRT815775	hsa-miR-134	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT815734	hsa-miR-2114	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815777	hsa-miR-3118	CLIP-seq
MIRT815736	hsa-miR-3125	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815740	hsa-miR-3162-3p	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815749	hsa-miR-3616-3p	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815752	hsa-miR-3916	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815780	hsa-miR-4446-3p	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815781	hsa-miR-4450	CLIP-seq
MIRT815782	hsa-miR-4461	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815783	hsa-miR-4492	CLIP-seq
MIRT815784	hsa-miR-4498	CLIP-seq
MIRT815785	hsa-miR-4505	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815761	hsa-miR-4638-5p	CLIP-seq
MIRT815786	hsa-miR-4667-5p	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT815787	hsa-miR-4700-5p	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815764	hsa-miR-4721	CLIP-seq
MIRT815765	hsa-miR-4727-5p	CLIP-seq
MIRT815789	hsa-miR-4731-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815767	hsa-miR-4769-3p	CLIP-seq
MIRT815768	hsa-miR-4782-5p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815791	hsa-miR-548ae	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815792	hsa-miR-548aj	CLIP-seq
MIRT815793	hsa-miR-548am	CLIP-seq
MIRT815794	hsa-miR-548x	CLIP-seq
MIRT815795	hsa-miR-624	CLIP-seq
MIRT815796	hsa-miR-762	CLIP-seq
MIRT815772	hsa-miR-765	CLIP-seq
MIRT815774	hsa-miR-877	CLIP-seq
MIRT815797	hsa-miR-943	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815732	hsa-miR-1289	CLIP-seq
MIRT815775	hsa-miR-134	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT1941313	hsa-miR-203	CLIP-seq
MIRT815734	hsa-miR-2114	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815777	hsa-miR-3118	CLIP-seq
MIRT815736	hsa-miR-3125	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815740	hsa-miR-3162-3p	CLIP-seq
MIRT1941314	hsa-miR-335	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT1941315	hsa-miR-3612	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815752	hsa-miR-3916	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815761	hsa-miR-4638-5p	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT1941317	hsa-miR-4696	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT1941318	hsa-miR-4723-5p	CLIP-seq
MIRT815765	hsa-miR-4727-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815767	hsa-miR-4769-3p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815791	hsa-miR-548ae	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815792	hsa-miR-548aj	CLIP-seq
MIRT815793	hsa-miR-548am	CLIP-seq
MIRT815794	hsa-miR-548x	CLIP-seq
MIRT815795	hsa-miR-624	CLIP-seq
MIRT1941319	hsa-miR-650	CLIP-seq
MIRT815772	hsa-miR-765	CLIP-seq
MIRT815774	hsa-miR-877	CLIP-seq
MIRT815797	hsa-miR-943	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815742	hsa-miR-320a	CLIP-seq
MIRT815743	hsa-miR-320b	CLIP-seq
MIRT815744	hsa-miR-320c	CLIP-seq
MIRT815745	hsa-miR-320d	CLIP-seq
MIRT815746	hsa-miR-320e	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT815751	hsa-miR-3675-5p	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815755	hsa-miR-4429	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815773	hsa-miR-873	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815742	hsa-miR-320a	CLIP-seq
MIRT815743	hsa-miR-320b	CLIP-seq
MIRT815744	hsa-miR-320c	CLIP-seq
MIRT815745	hsa-miR-320d	CLIP-seq
MIRT815746	hsa-miR-320e	CLIP-seq
MIRT815751	hsa-miR-3675-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815755	hsa-miR-4429	CLIP-seq
MIRT815759	hsa-miR-4490	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815773	hsa-miR-873	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT1941313	hsa-miR-203	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815741	hsa-miR-3175	CLIP-seq
MIRT1941314	hsa-miR-335	CLIP-seq
MIRT1941315	hsa-miR-3612	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815753	hsa-miR-4278	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT1941317	hsa-miR-4696	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT1941318	hsa-miR-4723-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT1941319	hsa-miR-650	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT1941313	hsa-miR-203	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815741	hsa-miR-3175	CLIP-seq
MIRT1941314	hsa-miR-335	CLIP-seq
MIRT1941315	hsa-miR-3612	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815753	hsa-miR-4278	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT1941317	hsa-miR-4696	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT1941318	hsa-miR-4723-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT1941319	hsa-miR-650	CLIP-seq

Gene ontology (GO) Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	31796734
GO:0000793	Component	Condensed chromosome	IBA
GO:0000793	Component	Condensed chromosome	IDA	28841419
GO:0000793	Component	Condensed chromosome	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IDA	28841419, 32792394
GO:0005515	Function	Protein binding	IDA	31796734
GO:0005515	Function	Protein binding	IPI	12163176, 22399800, 22770216, 25502805, 25910212, 31515488, 31796734, 32296183, 32814053, 37542259
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18005698, 22194607
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	18005698, 22194607
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IDA	31796734
GO:0006325	Process	Chromatin organization	IDA	28841419
GO:0006979	Process	Response to oxidative stress	IDA	31796734
GO:0007084	Process	Mitotic nuclear membrane reassembly	IDA	28841419
GO:0009615	Process	Response to virus	TAS	9465049
GO:0010836	Process	Negative regulation of protein ADP-ribosylation	IDA	31796734
GO:0015074	Process	DNA integration	IEA
GO:0032480	Process	Negative regulation of type I interferon production	IDA	32792394
GO:0032481	Process	Positive regulation of type I interferon production	IDA	25636800
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16155580
GO:0042803	Function	Protein homodimerization activity	IPI	22399800
GO:0045071	Process	Negative regulation of viral genome replication	IDA	18005698
GO:0045824	Process	Negative regulation of innate immune response	IDA	32792394
GO:0051276	Process	Chromosome organization	IBA
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800, 30842659, 30842662, 32911482, 32912999
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	32792394

Other IDs

• MIM: 603811
• HGNC: 17397
• e!Ensembl: ENSG00000175334

Protein

• UniProt ID: O75531
• Protein name: Barrier-to-autointegration factor (Breakpoint cluster region protein 1) [Cleaved into: Barrier-to-autointegration factor, N-terminally processed]
• Protein function: Non-specific DNA-binding protein that plays key roles in mitotic nuclear reassembly, chromatin organization, DNA damage response, gene expression and intrinsic immunity against foreign DNA (PubMed:10908652, PubMed:11792822, PubMed:12163470, PubM
• PDB: 1CI4 , 1QCK , 2BZF , 2EZX , 2EZY , 2EZZ , 2ODG , 6GHD , 6RPR , 6UNT , 6URE , 6URJ , 6URK , 6URL , 6URN , 6URR , 6URZ , 6US0 , 6US1 , 6US7 , 6USB , 6USD , 6USI , 7ABM , 7NDY , 7Z21 , 9J8M , 9J8N , 9J8O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02961	BAF	1 → 88	Barrier to autointegration factor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in colon, brain, heart, kidney, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen and testis. Not detected in thymus and peripheral blood leukocytes. {ECO:0000269|Pub
• Sequence:

  MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
  EWLKDTCGANAKQSRDCFGCLREWCDAFL

• Sequence length: 89

Pathways

Reactome Pathway

Integration of provirus

2-LTR circle formation

Integration of viral DNA into host genomic DNA

Autointegration results in viral DNA circles

APOBEC3G mediated resistance to HIV-1 infection

Vpr-mediated nuclear import of PICs

Nuclear Envelope Breakdown

Initiation of Nuclear Envelope (NE) Reformation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Nestor-Guillermo progeria syndrome	Uncertain significance; Likely benign; Benign; no classifications from unflagged records	ClinVar ClinGen	21549337,21932319,32783369,36039758,36842139, ClinGen report	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining Show/Hide Text Mining Associations (77)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atherosclerosis	Atherosclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25169753		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	21549337	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40664994	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31392992	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29397868	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25370573		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37432996	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25658920		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25658920		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSIP1 6 shared pathwaysVpr-mediated nuclear import of PICs, Integration of provirus, 2-LTR circle formation, Integration of viral DNA into host genomic DNA, Autointegration results in viral DNA circles, APOBEC3G mediated resistance to HIV-1 infection Related via 6 shared pathways including Vpr-mediated nuclear import of PICs, Integration of provirus. HMGA1 6 shared pathwaysVpr-mediated nuclear import of PICs, Integration of provirus, 2-LTR circle formation, Integration of viral DNA into host genomic DNA, Autointegration results in viral DNA circles, APOBEC3G mediated resistance to HIV-1 infection Related via 6 shared pathways including Vpr-mediated nuclear import of PICs, Integration of provirus. VRK1 2 shared pathwaysNuclear Envelope Breakdown, Initiation of Nuclear Envelope (NE) Reformation Related via 2 shared pathways including Nuclear Envelope Breakdown, Initiation of Nuclear Envelope (NE) Reformation. VRK2 2 shared pathwaysNuclear Envelope Breakdown, Initiation of Nuclear Envelope (NE) Reformation Related via 2 shared pathways including Nuclear Envelope Breakdown, Initiation of Nuclear Envelope (NE) Reformation. LEMD3 2 shared pathwaysNuclear Envelope Breakdown, Initiation of Nuclear Envelope (NE) Reformation Related via 2 shared pathways including Nuclear Envelope Breakdown, Initiation of Nuclear Envelope (NE) Reformation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSIP1	0	[]	6	["Vpr-mediated nuclear import of PICs","Integration of provirus","2-LTR circle formation","Integration of viral DNA into host genomic DNA","Autointegration results in viral DNA circles","APOBEC3G mediated resistance to HIV-1 infection"]	0	[]
HMGA1	0	[]	6	["Vpr-mediated nuclear import of PICs","Integration of provirus","2-LTR circle formation","Integration of viral DNA into host genomic DNA","Autointegration results in viral DNA circles","APOBEC3G mediated resistance to HIV-1 infection"]	0	[]
VRK1	0	[]	2	["Nuclear Envelope Breakdown","Initiation of Nuclear Envelope (NE) Reformation"]	0	[]
VRK2	0	[]	2	["Nuclear Envelope Breakdown","Initiation of Nuclear Envelope (NE) Reformation"]	0	[]
LEMD3	0	[]	2	["Nuclear Envelope Breakdown","Initiation of Nuclear Envelope (NE) Reformation"]	0	[]

Diseases Linked via Similar Genes

Metabolic syndrome Linked via 3 of 5 related genesPSIP1, HMGA1, VRK2 Diabetes mellitus type 2 Linked via 3 of 5 related genesPSIP1, HMGA1, VRK2 Schizophrenia Linked via 3 of 5 related genesHMGA1, VRK1, VRK2 Astrocytoma Linked via 2 of 5 related genesVRK1, VRK2 Neuroblastoma Linked via 2 of 5 related genesVRK1, VRK2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Metabolic syndrome	3	["PSIP1","HMGA1","VRK2"]
Diabetes mellitus type 2	3	["PSIP1","HMGA1","VRK2"]
Schizophrenia	3	["HMGA1","VRK1","VRK2"]
Astrocytoma	2	["VRK1","VRK2"]
Neuroblastoma	2	["VRK1","VRK2"]