Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	8815
Gene name	Barrier to autointegration nuclear assembly factor 1
Gene symbol	BANF1
Synonyms (NCBI Gene)	BAFBCRP1D14S1460NGPS
Chromosome	11
Chromosome location	11q13.1
Summary	The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both

243

Show/Hide all (243)

miRTarBase ID	miRNA	Experiments
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815730	hsa-miR-1255a	CLIP-seq
MIRT815731	hsa-miR-1255b	CLIP-seq
MIRT815732	hsa-miR-1289	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815734	hsa-miR-2114	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815736	hsa-miR-3125	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815740	hsa-miR-3162-3p	CLIP-seq
MIRT815741	hsa-miR-3175	CLIP-seq
MIRT815742	hsa-miR-320a	CLIP-seq
MIRT815743	hsa-miR-320b	CLIP-seq
MIRT815744	hsa-miR-320c	CLIP-seq
MIRT815745	hsa-miR-320d	CLIP-seq
MIRT815746	hsa-miR-320e	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815749	hsa-miR-3616-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT815751	hsa-miR-3675-5p	CLIP-seq
MIRT815752	hsa-miR-3916	CLIP-seq
MIRT815753	hsa-miR-4278	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815755	hsa-miR-4429	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815759	hsa-miR-4490	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815761	hsa-miR-4638-5p	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815764	hsa-miR-4721	CLIP-seq
MIRT815765	hsa-miR-4727-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815767	hsa-miR-4769-3p	CLIP-seq
MIRT815768	hsa-miR-4782-5p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815772	hsa-miR-765	CLIP-seq
MIRT815773	hsa-miR-873	CLIP-seq
MIRT815774	hsa-miR-877	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815730	hsa-miR-1255a	CLIP-seq
MIRT815731	hsa-miR-1255b	CLIP-seq
MIRT815732	hsa-miR-1289	CLIP-seq
MIRT815775	hsa-miR-134	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT815734	hsa-miR-2114	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815777	hsa-miR-3118	CLIP-seq
MIRT815736	hsa-miR-3125	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815740	hsa-miR-3162-3p	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815749	hsa-miR-3616-3p	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815752	hsa-miR-3916	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815780	hsa-miR-4446-3p	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815781	hsa-miR-4450	CLIP-seq
MIRT815782	hsa-miR-4461	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815783	hsa-miR-4492	CLIP-seq
MIRT815784	hsa-miR-4498	CLIP-seq
MIRT815785	hsa-miR-4505	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815761	hsa-miR-4638-5p	CLIP-seq
MIRT815786	hsa-miR-4667-5p	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT815787	hsa-miR-4700-5p	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815764	hsa-miR-4721	CLIP-seq
MIRT815765	hsa-miR-4727-5p	CLIP-seq
MIRT815789	hsa-miR-4731-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815767	hsa-miR-4769-3p	CLIP-seq
MIRT815768	hsa-miR-4782-5p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815791	hsa-miR-548ae	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815792	hsa-miR-548aj	CLIP-seq
MIRT815793	hsa-miR-548am	CLIP-seq
MIRT815794	hsa-miR-548x	CLIP-seq
MIRT815795	hsa-miR-624	CLIP-seq
MIRT815796	hsa-miR-762	CLIP-seq
MIRT815772	hsa-miR-765	CLIP-seq
MIRT815774	hsa-miR-877	CLIP-seq
MIRT815797	hsa-miR-943	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815732	hsa-miR-1289	CLIP-seq
MIRT815775	hsa-miR-134	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT1941313	hsa-miR-203	CLIP-seq
MIRT815734	hsa-miR-2114	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815777	hsa-miR-3118	CLIP-seq
MIRT815736	hsa-miR-3125	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815740	hsa-miR-3162-3p	CLIP-seq
MIRT1941314	hsa-miR-335	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT1941315	hsa-miR-3612	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815752	hsa-miR-3916	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815761	hsa-miR-4638-5p	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT1941317	hsa-miR-4696	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT1941318	hsa-miR-4723-5p	CLIP-seq
MIRT815765	hsa-miR-4727-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815767	hsa-miR-4769-3p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815791	hsa-miR-548ae	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815792	hsa-miR-548aj	CLIP-seq
MIRT815793	hsa-miR-548am	CLIP-seq
MIRT815794	hsa-miR-548x	CLIP-seq
MIRT815795	hsa-miR-624	CLIP-seq
MIRT1941319	hsa-miR-650	CLIP-seq
MIRT815772	hsa-miR-765	CLIP-seq
MIRT815774	hsa-miR-877	CLIP-seq
MIRT815797	hsa-miR-943	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815742	hsa-miR-320a	CLIP-seq
MIRT815743	hsa-miR-320b	CLIP-seq
MIRT815744	hsa-miR-320c	CLIP-seq
MIRT815745	hsa-miR-320d	CLIP-seq
MIRT815746	hsa-miR-320e	CLIP-seq
MIRT815747	hsa-miR-3609	CLIP-seq
MIRT815751	hsa-miR-3675-5p	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815755	hsa-miR-4429	CLIP-seq
MIRT815756	hsa-miR-4447	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815758	hsa-miR-4472	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815769	hsa-miR-488	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT815771	hsa-miR-548ah	CLIP-seq
MIRT815773	hsa-miR-873	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT815737	hsa-miR-3126-5p	CLIP-seq
MIRT815742	hsa-miR-320a	CLIP-seq
MIRT815743	hsa-miR-320b	CLIP-seq
MIRT815744	hsa-miR-320c	CLIP-seq
MIRT815745	hsa-miR-320d	CLIP-seq
MIRT815746	hsa-miR-320e	CLIP-seq
MIRT815751	hsa-miR-3675-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815754	hsa-miR-4419a	CLIP-seq
MIRT815755	hsa-miR-4429	CLIP-seq
MIRT815759	hsa-miR-4490	CLIP-seq
MIRT815760	hsa-miR-4510	CLIP-seq
MIRT815763	hsa-miR-4710	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815773	hsa-miR-873	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT1941313	hsa-miR-203	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815741	hsa-miR-3175	CLIP-seq
MIRT1941314	hsa-miR-335	CLIP-seq
MIRT1941315	hsa-miR-3612	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815753	hsa-miR-4278	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT1941317	hsa-miR-4696	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT1941318	hsa-miR-4723-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT1941319	hsa-miR-650	CLIP-seq
MIRT815729	hsa-miR-1226	CLIP-seq
MIRT815733	hsa-miR-150	CLIP-seq
MIRT815776	hsa-miR-1911	CLIP-seq
MIRT1941313	hsa-miR-203	CLIP-seq
MIRT815735	hsa-miR-31	CLIP-seq
MIRT815738	hsa-miR-3128	CLIP-seq
MIRT815739	hsa-miR-3148	CLIP-seq
MIRT815741	hsa-miR-3175	CLIP-seq
MIRT1941314	hsa-miR-335	CLIP-seq
MIRT1941315	hsa-miR-3612	CLIP-seq
MIRT815748	hsa-miR-3613-3p	CLIP-seq
MIRT815750	hsa-miR-3667-5p	CLIP-seq
MIRT1941316	hsa-miR-3689d	CLIP-seq
MIRT815778	hsa-miR-3908	CLIP-seq
MIRT815779	hsa-miR-3942-5p	CLIP-seq
MIRT815753	hsa-miR-4278	CLIP-seq
MIRT815757	hsa-miR-4471	CLIP-seq
MIRT815762	hsa-miR-4668-5p	CLIP-seq
MIRT1941317	hsa-miR-4696	CLIP-seq
MIRT815788	hsa-miR-4703-5p	CLIP-seq
MIRT1941318	hsa-miR-4723-5p	CLIP-seq
MIRT815766	hsa-miR-4733-3p	CLIP-seq
MIRT815790	hsa-miR-4766-3p	CLIP-seq
MIRT815770	hsa-miR-522	CLIP-seq
MIRT1941319	hsa-miR-650	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	31796734
GO:0000793	Component	Condensed chromosome	IBA
GO:0000793	Component	Condensed chromosome	IDA	28841419
GO:0000793	Component	Condensed chromosome	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IDA	28841419, 32792394
GO:0005515	Function	Protein binding	IDA	31796734
GO:0005515	Function	Protein binding	IPI	12163176, 22399800, 22770216, 25502805, 25910212, 31515488, 31796734, 32296183, 32814053, 37542259
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18005698, 22194607
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	18005698, 22194607
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IDA	31796734
GO:0006325	Process	Chromatin organization	IDA	28841419
GO:0006979	Process	Response to oxidative stress	IDA	31796734
GO:0007084	Process	Mitotic nuclear membrane reassembly	IDA	28841419
GO:0009615	Process	Response to virus	TAS	9465049
GO:0010836	Process	Negative regulation of protein ADP-ribosylation	IDA	31796734
GO:0015074	Process	DNA integration	IEA
GO:0032480	Process	Negative regulation of type I interferon production	IDA	32792394
GO:0032481	Process	Positive regulation of type I interferon production	IDA	25636800
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16155580
GO:0042803	Function	Protein homodimerization activity	IPI	22399800
GO:0045071	Process	Negative regulation of viral genome replication	IDA	18005698
GO:0045824	Process	Negative regulation of innate immune response	IDA	32792394
GO:0051276	Process	Chromosome organization	IBA
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800, 30842659, 30842662, 32911482, 32912999
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	32792394

MIM	HGNC	e!Ensembl
603811	17397	ENSG00000175334

O75531

Protein name

Barrier-to-autointegration factor (Breakpoint cluster region protein 1) [Cleaved into: Barrier-to-autointegration factor, N-terminally processed]

Protein function

Non-specific DNA-binding protein that plays key roles in mitotic nuclear reassembly, chromatin organization, DNA damage response, gene expression and intrinsic immunity against foreign DNA (PubMed:10908652, PubMed:11792822, PubMed:12163470, PubM

PDB

1CI4 , 1QCK , 2BZF , 2EZX , 2EZY , 2EZZ , 2ODG , 6GHD , 6RPR , 6UNT , 6URE , 6URJ , 6URK , 6URL , 6URN , 6URR , 6URZ , 6US0 , 6US1 , 6US7 , 6USB , 6USD , 6USI , 7ABM , 7NDY , 7Z21 , 9J8M , 9J8N , 9J8O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02961	BAF	1 → 88	Barrier to autointegration factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in colon, brain, heart, kidney, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen and testis. Not detected in thymus and peripheral blood leukocytes. {ECO:0000269|Pub

Sequence

MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
EWLKDTCGANAKQSRDCFGCLREWCDAFL

Sequence length

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Nestor-Guillermo progeria syndrome	Uncertain significance; Likely benign; Benign; no classifications from unflagged records	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (77)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atherosclerosis	Atherosclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25169753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	21549337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40664994	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31392992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29397868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25370573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37432996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25658920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25658920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	21549337, 21932319, 26072104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	23929686, 25081545, 25168959, 25169878, 27511161, 27570168, 28787104, 29429572, 30123105, 31207137, 31243159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31217031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	27511161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	26806701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33799280, 34753942, 34906496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29754817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digitorenocerebral Syndrome	Digitorenocerebral Syndrome	BEFREE	25169878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28298069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28298069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31392992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30333046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30580808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	30613065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	35241061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27511161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23929686, 25169058, 25169878, 30123105, 30580808, 31243159, 31273213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	24674232, 26340334, 28649782, 30580808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Accelerated Phase	Myeloid leukemia	Pubtator	35269487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	28945250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28298069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25370573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30405787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23568486, 23644491, 23698369, 25169878, 27941796, 28030837, 28418626, 28847829, 29323272, 30333046, 30397315, 30898143, 31178587, 31267096, 31597964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25658920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	22127260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	36980188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	17698609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23644491, 23698369, 27941796, 29861296, 30405787, 31178587, 31273213		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	25195934, 29323272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nestor Guillermo progeria syndrome	Nestor Guillermo Progeria Syndrome	ORPHANET_DG	21549337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nestor Guillermo progeria syndrome	Nestor Guillermo Progeria Syndrome	GENOMICS_ENGLAND_DG	21549337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nestor Guillermo progeria syndrome	Nestor Guillermo Progeria Syndrome	UNIPROT_DG	21549337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nestor Guillermo progeria syndrome	Nestor Guillermo Progeria Syndrome	BEFREE	21932319, 25495845, 31796734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nestor Guillermo progeria syndrome	Nestor Guillermo Progeria Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nestor Guillermo progeria syndrome	Nestor Guillermo Progeria Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nestor-Guillermo progeria syndrome	Nestor Guillermo Progeria Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	23568486, 27941795, 30580808, 30898143, 31273213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	36980188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nicolaides Baraitser syndrome	Nicolaides Baraitser Syndrome	BEFREE	23929686, 25169058, 30123105, 31243159, 31288860, 31421289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome 2	Noonan Syndrome	BEFREE	27279612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36813848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	21932319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	22127260, 26072104, 31266244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33323379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28945250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	34836971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right bundle branch block	Bundle Branch Block	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	26343384, 29359803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	28844694, 31392992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	29894696, 36920288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Tachycardia	Sinus Tachycardia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	BEFREE	30580808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28298069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30405787		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	29861296, 29894696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35022313, 36142814, 40664994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BANF1 (barrier to autointegration nuclear assembly factor 1)