BAIAP3 (BAI1 associated protein 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8938
• Gene name: BAI1 associated protein 3
• Gene symbol: BAIAP3
• Synonyms (NCBI Gene): BAP3
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: This p53-target gene encodes a brain-specific angiogenesis inhibitor. The protein is a seven-span transmembrane protein and a member of the secretin receptor family. It interacts with the cytoplasmic region of brain-specific angiogenesis inhibitor 1. This

miRNA Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT495639	hsa-miR-3141	PAR-CLIP	22291592
MIRT495638	hsa-miR-4685-5p	PAR-CLIP	22291592
MIRT495637	hsa-miR-6837-5p	PAR-CLIP	22291592
MIRT495636	hsa-miR-4462	PAR-CLIP	22291592
MIRT495639	hsa-miR-3141	PAR-CLIP	22291592
MIRT495638	hsa-miR-4685-5p	PAR-CLIP	22291592
MIRT495637	hsa-miR-6837-5p	PAR-CLIP	22291592
MIRT495636	hsa-miR-4462	PAR-CLIP	22291592
MIRT734845	hsa-miR-1972	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	33561007
MIRT495639	hsa-miR-3141	PAR-CLIP	22291592
MIRT495638	hsa-miR-4685-5p	PAR-CLIP	22291592
MIRT495637	hsa-miR-6837-5p	PAR-CLIP	22291592
MIRT495636	hsa-miR-4462	PAR-CLIP	22291592
MIRT495639	hsa-miR-3141	PAR-CLIP	22291592
MIRT495638	hsa-miR-4685-5p	PAR-CLIP	22291592
MIRT495637	hsa-miR-6837-5p	PAR-CLIP	22291592
MIRT495636	hsa-miR-4462	PAR-CLIP	22291592
MIRT815581	hsa-miR-1226	CLIP-seq
MIRT815582	hsa-miR-1233	CLIP-seq
MIRT815583	hsa-miR-125a-3p	CLIP-seq
MIRT815584	hsa-miR-1262	CLIP-seq
MIRT815585	hsa-miR-129-3p	CLIP-seq
MIRT815586	hsa-miR-190	CLIP-seq
MIRT815587	hsa-miR-190b	CLIP-seq
MIRT815588	hsa-miR-210	CLIP-seq
MIRT815589	hsa-miR-3189-3p	CLIP-seq
MIRT815590	hsa-miR-3201	CLIP-seq
MIRT815591	hsa-miR-377	CLIP-seq
MIRT815592	hsa-miR-3934	CLIP-seq
MIRT815593	hsa-miR-455-5p	CLIP-seq
MIRT815594	hsa-miR-4701-3p	CLIP-seq
MIRT815595	hsa-miR-4701-5p	CLIP-seq
MIRT815596	hsa-miR-4791	CLIP-seq
MIRT815597	hsa-miR-588	CLIP-seq
MIRT815598	hsa-miR-764	CLIP-seq
MIRT815599	hsa-miR-1324	CLIP-seq
MIRT1941267	hsa-miR-1207-5p	CLIP-seq
MIRT1941268	hsa-miR-1285	CLIP-seq
MIRT1941269	hsa-miR-1286	CLIP-seq
MIRT1941270	hsa-miR-1343	CLIP-seq
MIRT1941271	hsa-miR-3160-3p	CLIP-seq
MIRT1941272	hsa-miR-3169	CLIP-seq
MIRT1941273	hsa-miR-3187-5p	CLIP-seq
MIRT1941274	hsa-miR-3657	CLIP-seq
MIRT1941275	hsa-miR-4487	CLIP-seq
MIRT1941276	hsa-miR-4669	CLIP-seq
MIRT1941277	hsa-miR-4736	CLIP-seq
MIRT1941278	hsa-miR-4740-5p	CLIP-seq
MIRT1941279	hsa-miR-4763-3p	CLIP-seq
MIRT1941280	hsa-miR-558	CLIP-seq
MIRT1941281	hsa-miR-612	CLIP-seq
MIRT815599	hsa-miR-1324	CLIP-seq
MIRT2180044	hsa-miR-27a	CLIP-seq
MIRT2180045	hsa-miR-27b	CLIP-seq
MIRT2180046	hsa-miR-329	CLIP-seq
MIRT2180047	hsa-miR-362-3p	CLIP-seq
MIRT2180048	hsa-miR-3678-3p	CLIP-seq
MIRT2180049	hsa-miR-513a-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA
GO:0000149	Function	SNARE binding	IDA	28626000
GO:0000149	Function	SNARE binding	IPI	28626000
GO:0001956	Process	Positive regulation of neurotransmitter secretion	IBA
GO:0001956	Process	Positive regulation of neurotransmitter secretion	IMP	28626000
GO:0005509	Function	Calcium ion binding	IDA	28626000
GO:0005515	Function	Protein binding	IPI	9790924
GO:0005543	Function	Phospholipid binding	IDA	28626000
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	12498718, 28626000
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28626000
GO:0005886	Component	Plasma membrane	IEA
GO:0006887	Process	Exocytosis	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IPI	9790924
GO:0016020	Component	Membrane	IEA
GO:0019905	Function	Syntaxin binding	IPI	28626000
GO:0031045	Component	Dense core granule	IDA	28626000
GO:0031901	Component	Early endosome membrane	IDA	28626000
GO:0031902	Component	Late endosome membrane	IBA
GO:0031902	Component	Late endosome membrane	IDA	28626000
GO:0031902	Component	Late endosome membrane	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	ISS
GO:0032588	Component	Trans-Golgi network membrane	IBA
GO:0032588	Component	Trans-Golgi network membrane	IDA	28626000
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IMP	28626000
GO:0042147	Process	Retrograde transport, endosome to Golgi	IDA	28626000
GO:0046872	Function	Metal ion binding	IEA
GO:0050795	Process	Regulation of behavior	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0055038	Component	Recycling endosome membrane	IBA
GO:0055038	Component	Recycling endosome membrane	IDA	28626000
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099503	Component	Secretory vesicle	IBA
GO:1905413	Process	Regulation of dense core granule exocytosis	IBA
GO:1905413	Process	Regulation of dense core granule exocytosis	IDA	28626000
GO:1990502	Process	Dense core granule maturation	IMP	28626000

Other IDs

• MIM: 604009
• HGNC: 948
• e!Ensembl: ENSG00000007516

Protein

• UniProt ID: O94812
• Protein name: BAI1-associated protein 3 (BAP3) (Brain-specific angiogenesis inhibitor I-associated protein 3)
• Protein function: Functions in endosome to Golgi retrograde transport. In response to calcium influx, may interact with SNARE fusion receptors and membrane phospholipids to mediate endosome fusion with the trans-Golgi network. By promoting the recycling of secret
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	1025 → 1134	C2 domain	Domain
  PF00168	C2	195 → 315	C2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain (PubMed:9790924). Also expressed in nonneural tissues such as breast and testes epithelium (PubMed:12498718). {ECO:0000269|PubMed:12498718, ECO:0000269|PubMed:9790924}.
• Sequence:

  MRPRGAAFAAGPPGDLHLGTAIGFAGAIWRSRSPAMSTLLDIKSSVLRQVQVCPSFRRRT
  EQDPGSASADPQEPATGAWKPGDGVEFFAHMRLMLKKGEGRQGLPCLEVPLRSGSPAPPE
  PVDPSLGLRALAPEEVEMLYEEALYTVLYRAGTMGPDQVDDEEALLSYLQQVFGTSLEEH
  TEAIERVRKAKAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPASDATREPRAQKEQ
  RFGFRKGSKRGGPLPAKCIQVTEVKSSTLNPVWKEHFLFEIEDVSTDQLHLDIWDHDDDV
  SLVEACRKLNEVIGLKGMGRYFKQIVKSARANGTAGPTEDHTDDFLGCLNIPVREVPVAG
  VDRWFKLEPRSSASRVQGHCHLVLKLITTQRDTAMSQRGRSGFLSHLLLLSHLLRLEHSA
  EEPNSSSWRGELSTPAATILCLHGAQSNLSPLQLAVLHWQVSSRHHQTCTLDYSYLLGLL
  EDMQAHWEEAPSLPQEQEESLADSLSAFSEFGLQLLRQLRDYFPATNSTAVHRLELLLKC
  LGKLQLFQPSFEICPFESELNMDIAAALKRGNREWYDRILNDKSPREQPGPQRLPGLVVL
  ADAVYDDLQFCYSVYASLFHSILNVDVFTLTFRQLERLVAEEAWVLTEELSPKMTLEVAS
  GLFELYLTLADLQRFWDSIPGRDSRSLALAGIHAPFLPAVKLWFQVLRDQAKWRLQGAVD
  MDTLEPVDASSRHSSSAATAGLCLSHIQELWVRLAWPDPAQAQGLGTQLGQDVCEATLFY
  TELLRKKVDTQPGAAGEAVSEALCVVLNNVELVRKAAGQALKGLAWPEGATGPEGVLPRP
  LLSCTQALDDDLQREAHTVTAHLTSKMVGDIRKYVQHISLSPDSIQNDEAVAPLMKYLDE
  KLALLNASLVKGNLSRVLEALWELLLQAILQALGANRDVSADFYSRFHFTLEALVSFFHA
  EGQGLPLESLRDGSYKRLKEELRLHKCSTRECIEQFYLDKLKQRTLEQNRFGRLSVRCHY
  EAAEQRLAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYD
  ELFYFSVPAEACRRRAACVLFTVMDHDWLSTNDFAGEAALGLGGVTGVARPQVGGGARAG
  QPVTLHLCRPRAQVRSALRRLEGRTSKEAQEFVKKLKELEKCMEADP

• Sequence length: 1187

Pathways

KEGG Pathway:

Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BAIAP3-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anxiety	Anxiety Disorder	BEFREE	23698091		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23698091		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31200767	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29635173		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for BAIAP3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BAIAP3.