BAIAP2 (BAR/IMD domain containing adaptor protein 2)

Gene

• Entrez ID: 10458
• Gene name: BAR/IMD domain containing adaptor protein 2
• Gene symbol: BAIAP2
• Synonyms (NCBI Gene): BAP2, FLAF3, IRSP53, WAML
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor ty

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037874	hsa-miR-455-3p	CLASH	23622248
MIRT815462	hsa-miR-1237	CLIP-seq
MIRT815463	hsa-miR-15a	CLIP-seq
MIRT815464	hsa-miR-15b	CLIP-seq
MIRT815465	hsa-miR-16	CLIP-seq
MIRT815466	hsa-miR-195	CLIP-seq
MIRT815467	hsa-miR-214	CLIP-seq
MIRT815468	hsa-miR-2355-5p	CLIP-seq
MIRT815469	hsa-miR-3135b	CLIP-seq
MIRT815470	hsa-miR-3187-3p	CLIP-seq
MIRT815471	hsa-miR-3619-5p	CLIP-seq
MIRT815472	hsa-miR-424	CLIP-seq
MIRT815473	hsa-miR-4434	CLIP-seq
MIRT815474	hsa-miR-4436b-3p	CLIP-seq
MIRT815475	hsa-miR-4516	CLIP-seq
MIRT815476	hsa-miR-4529-5p	CLIP-seq
MIRT815477	hsa-miR-4722-5p	CLIP-seq
MIRT815478	hsa-miR-4755-3p	CLIP-seq
MIRT815479	hsa-miR-4768-3p	CLIP-seq
MIRT815480	hsa-miR-497	CLIP-seq
MIRT815481	hsa-miR-761	CLIP-seq
MIRT815482	hsa-miR-938	CLIP-seq
MIRT815483	hsa-miR-1268	CLIP-seq
MIRT815484	hsa-miR-1268b	CLIP-seq
MIRT815485	hsa-miR-361-3p	CLIP-seq
MIRT815486	hsa-miR-4447	CLIP-seq
MIRT815487	hsa-miR-4466	CLIP-seq
MIRT815488	hsa-miR-4472	CLIP-seq
MIRT815489	hsa-miR-4488	CLIP-seq
MIRT815490	hsa-miR-4697-5p	CLIP-seq
MIRT815491	hsa-miR-4726-3p	CLIP-seq
MIRT815492	hsa-miR-675	CLIP-seq
MIRT815493	hsa-miR-1193	CLIP-seq
MIRT815494	hsa-miR-1287	CLIP-seq
MIRT815495	hsa-miR-1827	CLIP-seq
MIRT815496	hsa-miR-219-1-3p	CLIP-seq
MIRT815468	hsa-miR-2355-5p	CLIP-seq
MIRT815497	hsa-miR-3126-5p	CLIP-seq
MIRT815469	hsa-miR-3135b	CLIP-seq
MIRT815498	hsa-miR-3150a-3p	CLIP-seq
MIRT815499	hsa-miR-3175	CLIP-seq
MIRT815500	hsa-miR-3190	CLIP-seq
MIRT815501	hsa-miR-3194-3p	CLIP-seq
MIRT815502	hsa-miR-3202	CLIP-seq
MIRT815503	hsa-miR-3612	CLIP-seq
MIRT815504	hsa-miR-3622b-5p	CLIP-seq
MIRT815505	hsa-miR-3663-3p	CLIP-seq
MIRT815506	hsa-miR-3670	CLIP-seq
MIRT815507	hsa-miR-4533	CLIP-seq
MIRT815508	hsa-miR-4694-5p	CLIP-seq
MIRT815477	hsa-miR-4722-5p	CLIP-seq
MIRT815509	hsa-miR-4728-5p	CLIP-seq
MIRT815510	hsa-miR-4758-3p	CLIP-seq
MIRT815479	hsa-miR-4768-3p	CLIP-seq
MIRT815511	hsa-miR-4783-3p	CLIP-seq
MIRT815512	hsa-miR-650	CLIP-seq
MIRT815513	hsa-miR-658	CLIP-seq
MIRT815514	hsa-miR-939	CLIP-seq
MIRT815515	hsa-miR-940	CLIP-seq
MIRT1941247	hsa-miR-3065-3p	CLIP-seq
MIRT1941248	hsa-miR-3689d	CLIP-seq
MIRT2180004	hsa-miR-1293	CLIP-seq
MIRT2180005	hsa-miR-146b-3p	CLIP-seq
MIRT2180006	hsa-miR-181a	CLIP-seq
MIRT2180007	hsa-miR-181b	CLIP-seq
MIRT2180008	hsa-miR-181c	CLIP-seq
MIRT2180009	hsa-miR-181d	CLIP-seq
MIRT2180010	hsa-miR-2113	CLIP-seq
MIRT2180011	hsa-miR-3173-5p	CLIP-seq
MIRT2180012	hsa-miR-323-5p	CLIP-seq
MIRT2180013	hsa-miR-342-5p	CLIP-seq
MIRT2180014	hsa-miR-3618	CLIP-seq
MIRT2180015	hsa-miR-4262	CLIP-seq
MIRT815486	hsa-miR-4447	CLIP-seq
MIRT815488	hsa-miR-4472	CLIP-seq
MIRT2180016	hsa-miR-4483	CLIP-seq
MIRT2180017	hsa-miR-4651	CLIP-seq
MIRT2180018	hsa-miR-4664-5p	CLIP-seq
MIRT2180019	hsa-miR-4675	CLIP-seq
MIRT2180020	hsa-miR-4711-3p	CLIP-seq
MIRT2180021	hsa-miR-4741	CLIP-seq
MIRT2180022	hsa-miR-4793-3p	CLIP-seq
MIRT2180023	hsa-miR-592	CLIP-seq
MIRT2180024	hsa-miR-593	CLIP-seq
MIRT2180025	hsa-miR-599	CLIP-seq
MIRT2180026	hsa-miR-608	CLIP-seq
MIRT2180027	hsa-miR-874	CLIP-seq
MIRT2180028	hsa-miR-934	CLIP-seq
MIRT815485	hsa-miR-361-3p	CLIP-seq
MIRT815495	hsa-miR-1827	CLIP-seq
MIRT815496	hsa-miR-219-1-3p	CLIP-seq
MIRT815503	hsa-miR-3612	CLIP-seq
MIRT815505	hsa-miR-3663-3p	CLIP-seq
MIRT815477	hsa-miR-4722-5p	CLIP-seq
MIRT815479	hsa-miR-4768-3p	CLIP-seq
MIRT815512	hsa-miR-650	CLIP-seq
MIRT815513	hsa-miR-658	CLIP-seq
MIRT815515	hsa-miR-940	CLIP-seq
MIRT2483421	hsa-miR-125a-3p	CLIP-seq
MIRT2483422	hsa-miR-3934	CLIP-seq
MIRT2483423	hsa-miR-4419a	CLIP-seq
MIRT815473	hsa-miR-4434	CLIP-seq
MIRT2483424	hsa-miR-4510	CLIP-seq
MIRT815475	hsa-miR-4516	CLIP-seq
MIRT2483425	hsa-miR-4687-5p	CLIP-seq
MIRT2483426	hsa-miR-764	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001726	Component	Ruffle	IEA
GO:0005515	Function	Protein binding	IPI	11130076, 11157984, 11696321, 12598619, 15289329, 16189514, 17003044, 18448434, 19171758, 19460367, 19564905, 19933840, 20936779, 21311754, 21893288, 24076653, 24189400, 24584464, 24658140, 24705354, 25416956, 25519916, 25814554, 26496610, 28514442, 31980649, 32296183, 32814053, 339
GO:0005515	Function	Protein binding	TAS	10343108
GO:0005654	Component	Nucleoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10343108
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	19366662
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS	10343108
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0007009	Process	Plasma membrane organization	IEA
GO:0007409	Process	Axonogenesis	TAS	10343108
GO:0008093	Function	Cytoskeletal anchor activity	IEA
GO:0008093	Function	Cytoskeletal anchor activity	TAS	10343108
GO:0008286	Process	Insulin receptor signaling pathway	TAS	10343108
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	19366662
GO:0016020	Component	Membrane	IEA
GO:0016358	Process	Dendrite development	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030165	Function	PDZ domain binding	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	19366662
GO:0035418	Process	Protein localization to synapse	IEA
GO:0042802	Function	Identical protein binding	IPI	11696321, 14752106, 24076653, 24584464, 25416956
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043198	Component	Dendritic shaft	IEA
GO:0044306	Component	Neuron projection terminus	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051017	Process	Actin filament bundle assembly	IBA
GO:0051017	Process	Actin filament bundle assembly	IEA
GO:0051017	Process	Actin filament bundle assembly	ISS
GO:0051764	Process	Actin crosslink formation	IBA
GO:0051764	Process	Actin crosslink formation	IEA
GO:0051764	Process	Actin crosslink formation	ISS
GO:0060076	Component	Excitatory synapse	IEA
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	IEA
GO:0061845	Component	Neuron projection branch point	IEA
GO:0061846	Component	Dendritic spine cytoplasm	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070064	Function	Proline-rich region binding	IDA	19366662
GO:0070064	Function	Proline-rich region binding	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0097110	Function	Scaffold protein binding	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:0099523	Component	Presynaptic cytosol	IEA
GO:0099524	Component	Postsynaptic cytosol	IEA
GO:1905232	Process	Cellular response to L-glutamate	IEA
GO:1905274	Process	Regulation of modification of postsynaptic actin cytoskeleton	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IEA

Other IDs

• MIM: 605475
• HGNC: 947
• e!Ensembl: ENSG00000175866

Protein

• UniProt ID: Q9UQB8
• Protein name: BAR/IMD domain-containing adapter protein 2 (Brain-specific angiogenesis inhibitor 1-associated protein 2) (BAI-associated protein 2) (BAI1-associated protein 2) (Protein BAP2) (Fas ligand-associated factor 3) (FLAF3) (Insulin receptor substrate p53/p58)
• Protein function: Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin c
• PDB: 1WDZ, 1Y2O, 2YKT, 3RNJ, 4JS0, 6BCR, 6BCY, 6BD1, 6BD2, 6BQT, 6ZEG, 6ZEI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08397	IMD	17 → 237	IRSp53/MIM homology domain	Family
  PF07653	SH3_2	378 → 435	Variant SH3 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 4 are expressed almost exclusively in brain. Isoform 4 is barely detectable in placenta, prostate and testis. A short isoform is ubiquitous, with the highest expression in liver, prostate, testis and placenta. {EC
• Sequence:

  MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
  ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
  KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
  DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA
  VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN
  GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT
  LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
  TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA
  QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGRE
  HGDGSARTLAGR

• Sequence length: 552

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Uncertain significance	ClinVar Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	23537733	Inhibit	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	25676789		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	24377651, 28938222	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	19733838, 24377651, 26275848, 28938222		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	24377651	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26275848		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	29871690, 33216456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34616498	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26275848		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37211381	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35159257	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32681239	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32375686	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28067313		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	25676789		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	27285756	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26275848		★☆☆☆☆ Found in Text Mining only
Keratitis Dendritic	Herpetic keratitis	Pubtator	28195572	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	26275848		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20418908		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36839421	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34523824	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28195572		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	28195572	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	28489605	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40596964	Associate	★☆☆☆☆ Found in Text Mining only