BAGE3 (BAGE family member 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 85318
Gene name BAGE family member 3
Gene symbol BAGE3
Synonyms (NCBI Gene)
CT2.3
Chromosome 21
Chromosome location 21p11.2
miRNA miRNA information provided by mirtarbase database.
323 Show/Hide all (323)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT814961 hsa-miR-103a CLIP-seq
MIRT814962 hsa-miR-107 CLIP-seq
MIRT814963 hsa-miR-1208 CLIP-seq
MIRT814964 hsa-miR-1225-5p CLIP-seq
MIRT814965 hsa-miR-1231 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617777 15728 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86Y29
Protein name B melanoma antigen 3 (Cancer/testis antigen 2.3) (CT2.3)
Protein function Unknown. Candidate gene encoding tumor antigens.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08180 BAGE 1 → 28 B melanoma antigen family Family
Tissue specificity TISSUE SPECIFICITY: Not expressed in normal tissues except in testis. Expressed in melanoma, bladder and lung carcinomas.
Sequence 
MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPR
CIIILVLQEPTPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATAQETS
Sequence length 109
Interactions View interactions

No strongly related genes found yet for BAGE3.

No additional diseases found yet through genes similar to BAGE3.