BAALC-AS2 (BAALC antisense RNA 2)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 157556 |
| Gene name | BAALC antisense RNA 2 |
| Gene symbol | BAALC-AS2 |
| Synonyms (NCBI Gene) |
BAALCOSC8orf56
|
| Chromosome | 8 |
| Chromosome location | 8q22.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0C853 |
| Protein name | Putative uncharacterized protein BAALC-AS2 (BAALC antisense RNA 2) (BAALC antisense gene protein 2) (BAALC opposite strand protein) |
| Family and domains | |
| Sequence |
MSLKSWHPQSKTKRVGASEGNPQWGSGSMEAPLLSSFLPPLASEAELTGNTWFLHRCSCI |
| Sequence length | 105 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with BAALC-AS2 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to BAALC-AS2 (see Related Genes above), that are NOT already directly curated for BAALC-AS2 itself -- a lead worth checking, not a confirmed association.
0
|
|