B3GALT9 (beta-1,3-galactosyltransferase 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100288842
Gene name Beta-1,3-galactosyltransferase 9
Gene symbol B3GALT9
Synonyms (NCBI Gene)
B3GNT10
Chromosome 9
Chromosome location 9q33.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0000139 Component Golgi membrane IEA
GO:0005794 Component Golgi apparatus IEA
GO:0006486 Process Protein glycosylation IEA
GO:0006493 Process Protein O-linked glycosylation IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620239 53652 ENSG00000214654
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MXE2
Protein name Beta-1,3-galactosyltransferase 9 (EC 2.4.1.-) (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 10)
Protein function Putative glycosyltransferase that could catalyze the transfer of galactose residues from UDP-alpha-D-galactose.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01762 Galactosyl_T 98 → 289 Galactosyltransferase Family
Sequence 
MQVTFCRLRTHQWCFILFNVILFHALLFGTDFVEEYFLHSLPYIDVKVLEIKNKARKLNI
EPLRSNLSKYYVLSQSEICKGKNIFLLSLIFSSPGNGTRRDLIRKTWGNVTSVQGHPILT
LFALGMPVSVTTQKEINKESCKNNDIIEGIFLDSSENQTLKIIAMIQWAVAFCPNALFIL
KVDEETFVNLPSLVDYLLNLKEHLEDIYVGRVLHQVTPNRDPQNRDFVPLSEYPEKYYPD
YCSGEAFIMSQDVARMMYVVFKEVPMMVPADVFVGICAKFIGLIPIHSSRFSGKRHIRYN
RCCYKFIFTSSEIADPEMPLAWKEINDGKECTLFETSYELISCKLLTYLDSFKRFHMGTI
KNNLMYFAD
Sequence length 369
Interactions View interactions

No strongly related genes found yet for B3GALT9.

No additional diseases found yet through genes similar to B3GALT9.