AWAT1 (acyl-CoA wax alcohol acyltransferase 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 158833
• Gene name: Acyl-CoA wax alcohol acyltransferase 1
• Gene symbol: AWAT1
• Synonyms (NCBI Gene): DGA2, DGAT2L3
• Chromosome: X
• Chromosome location: Xq13.1
• Summary: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a c

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT812347	hsa-miR-140-3p	CLIP-seq
MIRT812348	hsa-miR-182	CLIP-seq
MIRT812349	hsa-miR-3150a-5p	CLIP-seq
MIRT812350	hsa-miR-3150b-5p	CLIP-seq
MIRT812351	hsa-miR-3163	CLIP-seq
MIRT812352	hsa-miR-3662	CLIP-seq
MIRT812353	hsa-miR-410	CLIP-seq
MIRT812354	hsa-miR-4469	CLIP-seq
MIRT812355	hsa-miR-4470	CLIP-seq
MIRT812356	hsa-miR-4729	CLIP-seq
MIRT812357	hsa-miR-4795-3p	CLIP-seq
MIRT812355	hsa-miR-4470	CLIP-seq
MIRT812355	hsa-miR-4470	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008374	Function	O-acyltransferase activity	IEA
GO:0010025	Process	Wax biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	TAS
GO:0047196	Function	Long-chain-alcohol O-fatty-acyltransferase activity	EXP	15671038
GO:0047196	Function	Long-chain-alcohol O-fatty-acyltransferase activity	IBA
GO:0047196	Function	Long-chain-alcohol O-fatty-acyltransferase activity	IEA

Other IDs

• MIM: 300924
• HGNC: 23252
• e!Ensembl: ENSG00000204195

Protein

• UniProt ID: Q58HT5
• Protein name: Acyl-CoA wax alcohol acyltransferase 1 (EC 2.3.1.75) (Diacylglycerol O-acyltransferase 2-like protein 3) (Diacylglycerol acyltransferase 2) (Long-chain-alcohol O-fatty-acyltransferase 1)
• Protein function: Acyltransferase that catalyzes the formation of ester bonds between fatty alcohols and fatty acyl-CoAs to form wax monoesters (PubMed:15671038). Shows a strong preference for decyl alcohol (C10), with less activity towards C16 and C18 alcohols (
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03982	DAGAT	34 → 328	Diacylglycerol acyltransferase	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in skin, where it is limited to the sebaceous gland. Expressed in more mature, centrally located cells just before their rupture and sebum release. Also expressed in all tissues except spleen. Expressed at highe
• Sequence:

  MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPE
  RGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA
  TGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVG
  GVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKF
  QSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHA
  LYMDALHKLFDQHKTHYGCSETQKLFFL

• Sequence length: 328

Pathways

Reactome Pathway

Arachidonic acid metabolism

Wax biosynthesis

Related Genes

No strongly related genes found yet for AWAT1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to AWAT1.