Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51374
Gene name	All-trans retinoic acid induced differentiation factor
Gene symbol	ATRAID
Synonyms (NCBI Gene)	APR--3APR-3APR3C2orf28HSPC013PRO240p18
Chromosome	2
Chromosome location	2p23.3
Summary	This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. The use of alternative splice sites and promotors result in multiple transcript variants encoding different isoforms.[provided by

29 Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043815	hsa-miR-328-3p	CLASH	23622248
MIRT560133	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT560132	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT560131	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT560130	hsa-miR-3148	PAR-CLIP	20371350
MIRT560129	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT560128	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT560127	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT560133	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT560132	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT560131	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT560130	hsa-miR-3148	PAR-CLIP	20371350
MIRT560129	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT560128	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT560127	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT560133	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT560132	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT560131	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT560130	hsa-miR-3148	PAR-CLIP	20371350
MIRT560129	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT560128	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT560127	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT560133	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT560132	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT560131	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT560130	hsa-miR-3148	PAR-CLIP	20371350
MIRT560129	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT560128	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT560127	hsa-miR-6832-5p	PAR-CLIP	20371350

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18388313, 21723284, 29745899, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	21723284
GO:0005635	Component	Nuclear envelope	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	29745899
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006855	Process	Xenobiotic transmembrane transport	IDA	29745899
GO:0010468	Process	Regulation of gene expression	IDA	21723284
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IDA	21723284
GO:0033689	Process	Negative regulation of osteoblast proliferation	IDA	21723284
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	21723284
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	29745899
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IBA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	21723284
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21723284

MIM	HGNC	e!Ensembl
619682	24090	ENSG00000138085

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q6UW56
Protein name	All-trans retinoic acid-induced differentiation factor (Apoptosis-related protein 3) (APR-3) (p18)
Protein function	Promotes osteoblast cell differentiation and terminal mineralization. Plays a role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway. In osteoclasts, forms a transporter complex wi
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Weakly expressed in hematopoietic cell lines. {ECO:0000269\|PubMed:11042152}.
Sequence	MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELML HARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQ TLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQ CVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Sequence length	229
Interactions	View interactions

Related Genes Genes most often co-reported with ATRAID across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ATRAID.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ATRAID (see Related Genes above), that are NOT already directly curated for ATRAID itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ATRAID.

ATRAID (all-trans retinoic acid induced differentiation factor)