ATP6V1F (ATPase H+ transporting V1 subunit F)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 9296
Gene name ATPase H+ transporting V1 subunit F
Gene symbol ATP6V1F
Synonyms (NCBI Gene)
ATP6S14VATFVma7
Chromosome 7
Chromosome location 7q32.1
Summary This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort
miRNA miRNA information provided by mirtarbase database.
1023 Show/Hide all (1023)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT001650 hsa-let-7b-5p pSILAC 18668040
MIRT001650 hsa-let-7b-5p Proteomics;Other 18668040
MIRT039119 hsa-miR-769-3p CLASH 23622248
MIRT402084 hsa-miR-9500 PAR-CLIP 24398324
MIRT402078 hsa-miR-6760-5p PAR-CLIP 24398324
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32 Show/Hide all (32)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane NAS 32001091
GO:0000221 Component Vacuolar proton-transporting V-type ATPase, V1 domain ISS
GO:0005515 Function Protein binding IPI 18752060, 32296183, 33961781, 35271311
GO:0005765 Component Lysosomal membrane NAS 32001091
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607160 16832 ENSG00000128524
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16864
Protein name V-type proton ATPase subunit F (V-ATPase subunit F) (V-ATPase 14 kDa subunit) (Vacuolar proton pump subunit F)
Protein function Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:33065002). V-ATPase is responsibl
PDB 6WLZ , 6WM2 , 6WM3 , 6WM4 , 7U4T , 7UNF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01990 ATP-synt_F 8 → 109 ATP synthase (F/14-kDa) subunit Family
Sequence 
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
Sequence length 119
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Oxidative phosphorylation ROS and RNS production in phagocytes
Metabolic pathways Insulin receptor recycling
Phagosome Transferrin endocytosis and recycling
mTOR signaling pathway Amino acids regulate mTORC1
Synaptic vesicle cycle Ion channel transport
Collecting duct acid secretion  
Vibrio cholerae infection  
Epithelial cell signaling in Helicobacter pylori infection  
Human papillomavirus infection  
Rheumatoid arthritis  
Sort by:
ATP6V1G3 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1C2 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1D 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1A 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1B1 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome.
Distal renal tubular acidosis Linked via 2 of 5 related genesATP6V1C2, ATP6V1B1 Bipolar disorder Linked via 1 of 5 related genesATP6V1G3 Crohn disease Linked via 1 of 5 related genesATP6V1G3 Hyperthyroidism Linked via 1 of 5 related genesATP6V1G3 Inflammatory bowel disease Linked via 1 of 5 related genesATP6V1G3