ATP6V1E2 (ATPase H+ transporting V1 subunit E2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 90423
Gene name ATPase H+ transporting V1 subunit E2
Gene symbol ATP6V1E2
Synonyms (NCBI Gene)
ATP6E1ATP6EL2ATP6V1EL2VMA4
Chromosome 2
Chromosome location 2p21|2p16-p12
miRNA miRNA information provided by mirtarbase database.
19 Show/Hide all (19)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT052816 hsa-miR-3200-3p CLASH 23622248
MIRT809386 hsa-miR-141 CLIP-seq
MIRT809387 hsa-miR-144 CLIP-seq
MIRT809388 hsa-miR-200a CLIP-seq
MIRT809389 hsa-miR-3185 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0005515 Function Protein binding IPI 21516116, 25416956, 30021884, 32296183
GO:0005829 Component Cytosol TAS
GO:0006811 Process Monoatomic ion transport IEA
GO:0016241 Process Regulation of macroautophagy NAS 22982048
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617385 18125 ENSG00000250565
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96A05
Protein name V-type proton ATPase subunit E 2 (V-ATPase subunit E 2) (Vacuolar proton pump subunit E 2)
Protein function Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01991 vATP-synt_E 18 → 216 ATP synthase (E/31 kDa) subunit Family
Tissue specificity TISSUE SPECIFICITY: Testis specific. {ECO:0000269|PubMed:12036578}.
Sequence 
MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
LQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG
VEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKFFI
Sequence length 226
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Oxidative phosphorylation ROS and RNS production in phagocytes
Metabolic pathways Insulin receptor recycling
Phagosome Transferrin endocytosis and recycling
mTOR signaling pathway Amino acids regulate mTORC1
Synaptic vesicle cycle Ion channel transport
Collecting duct acid secretion  
Vibrio cholerae infection  
Epithelial cell signaling in Helicobacter pylori infection  
Human papillomavirus infection  
Rheumatoid arthritis  
Sort by:
ATP6V1G3 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1C2 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1D 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1A 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome. ATP6V1B1 13 shared pathwaysOxidative phosphorylation, Phagosome, mTOR signaling pathway, Synaptic vesicle cycle, Collecting duct acid secretion, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Rheumatoid arthritis, ROS and RNS production in phagocytes, Insulin receptor recycling, Transferrin endocytosis and recycling, Amino acids regulate mTORC1 +1 more Related via 13 shared pathways including Oxidative phosphorylation, Phagosome.
Distal renal tubular acidosis Linked via 2 of 5 related genesATP6V1C2, ATP6V1B1 Bipolar disorder Linked via 1 of 5 related genesATP6V1G3 Crohn disease Linked via 1 of 5 related genesATP6V1G3 Hyperthyroidism Linked via 1 of 5 related genesATP6V1G3 Inflammatory bowel disease Linked via 1 of 5 related genesATP6V1G3