ATP5F1EP2 (ATP synthase F1 subunit epsilon pseudogene 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 432369
Gene name ATP synthase F1 subunit epsilon pseudogene 2
Gene symbol ATP5F1EP2
Synonyms (NCBI Gene)
ATP5EP2
Chromosome 13
Chromosome location 13q12.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17 Show/Hide all (17)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HDA 20833797
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IBA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0005743 Component Mitochondrial inner membrane NAS 26297831
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 34026 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5VTU8
Protein name ATP synthase subunit epsilon-like protein, mitochondrial (ATP synthase F1 subunit epsilon pseudogene 2)
Protein function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases c
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04627 ATP-synt_Eps 3 → 50 Mitochondrial ATP synthase epsilon chain Family
Sequence 
MVAYWRQAGLSYIRYSQICAKVVRDALKTEFKANAKKTSGNSVKIVKVKKE
Sequence length 51
Interactions View interactions

No strongly related genes found yet for ATP5F1EP2.

No additional diseases found yet through genes similar to ATP5F1EP2.