ATP2B1 (ATPase plasma membrane Ca2+ transporting 1)

Gene

• Entrez ID: 490
• Gene name: ATPase plasma membrane Ca2+ transporting 1
• Gene symbol: ATP2B1
• Synonyms (NCBI Gene): MRD66, PMCA1, PMCA1kb
• Chromosome: 12
• Chromosome location: 12q21.33
• Summary: The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005818	hsa-miR-204-5p	Microarray	21282569
MIRT052579	hsa-let-7a-5p	CLASH	23622248
MIRT039645	hsa-miR-615-3p	CLASH	23622248
MIRT724532	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT136414	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT724531	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT724530	hsa-miR-3183	HITS-CLIP	19536157
MIRT724529	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT724528	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT136366	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT724527	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT724526	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT724525	hsa-miR-4469	HITS-CLIP	19536157
MIRT724524	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT384907	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT384905	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT724523	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT724522	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT136399	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT384906	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT561127	hsa-miR-4282	PAR-CLIP	20371350
MIRT561128	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT561126	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT561125	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT561124	hsa-miR-5697	PAR-CLIP	20371350
MIRT561123	hsa-miR-1297	PAR-CLIP	20371350
MIRT561122	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT561121	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT561119	hsa-miR-4465	PAR-CLIP	20371350
MIRT561120	hsa-miR-498	PAR-CLIP	20371350
MIRT441151	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT441152	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT441150	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT441151	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT441152	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT728259	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT728258	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT728257	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT728255	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT728256	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT728254	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT728253	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT728252	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT441150	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT724532	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT136414	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT724531	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT724530	hsa-miR-3183	HITS-CLIP	19536157
MIRT724529	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT724528	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT136366	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT724527	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT724526	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT724525	hsa-miR-4469	HITS-CLIP	19536157
MIRT724524	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT384907	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT384905	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT724523	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT724522	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT136399	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT384906	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT561127	hsa-miR-4282	PAR-CLIP	20371350
MIRT561128	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT561126	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT561125	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT561124	hsa-miR-5697	PAR-CLIP	20371350
MIRT561123	hsa-miR-1297	PAR-CLIP	20371350
MIRT561122	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT561121	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT561119	hsa-miR-4465	PAR-CLIP	20371350
MIRT561120	hsa-miR-498	PAR-CLIP	20371350
MIRT807482	hsa-miR-106a	CLIP-seq
MIRT807483	hsa-miR-106b	CLIP-seq
MIRT807484	hsa-miR-1185	CLIP-seq
MIRT807485	hsa-miR-1197	CLIP-seq
MIRT807486	hsa-miR-1208	CLIP-seq
MIRT807487	hsa-miR-1224-3p	CLIP-seq
MIRT807488	hsa-miR-1225-5p	CLIP-seq
MIRT807489	hsa-miR-1260	CLIP-seq
MIRT807490	hsa-miR-1260b	CLIP-seq
MIRT807491	hsa-miR-1264	CLIP-seq
MIRT807492	hsa-miR-1267	CLIP-seq
MIRT807493	hsa-miR-1279	CLIP-seq
MIRT807494	hsa-miR-128	CLIP-seq
MIRT807495	hsa-miR-1280	CLIP-seq
MIRT807496	hsa-miR-129-5p	CLIP-seq
MIRT807497	hsa-miR-1301	CLIP-seq
MIRT807498	hsa-miR-130a	CLIP-seq
MIRT807499	hsa-miR-130b	CLIP-seq
MIRT807500	hsa-miR-150	CLIP-seq
MIRT807501	hsa-miR-17	CLIP-seq
MIRT807502	hsa-miR-181a	CLIP-seq
MIRT807503	hsa-miR-181b	CLIP-seq
MIRT807504	hsa-miR-181c	CLIP-seq
MIRT807505	hsa-miR-181d	CLIP-seq
MIRT807506	hsa-miR-197	CLIP-seq
MIRT807507	hsa-miR-203	CLIP-seq
MIRT807508	hsa-miR-2052	CLIP-seq
MIRT807509	hsa-miR-20a	CLIP-seq
MIRT807510	hsa-miR-20b	CLIP-seq
MIRT807511	hsa-miR-216a	CLIP-seq
MIRT807512	hsa-miR-216b	CLIP-seq
MIRT807513	hsa-miR-223	CLIP-seq
MIRT807514	hsa-miR-27a	CLIP-seq
MIRT807515	hsa-miR-27b	CLIP-seq
MIRT807516	hsa-miR-301a	CLIP-seq
MIRT807517	hsa-miR-301b	CLIP-seq
MIRT807518	hsa-miR-3117-3p	CLIP-seq
MIRT807519	hsa-miR-3130-5p	CLIP-seq
MIRT807520	hsa-miR-3152-3p	CLIP-seq
MIRT807521	hsa-miR-3152-5p	CLIP-seq
MIRT807522	hsa-miR-3169	CLIP-seq
MIRT807523	hsa-miR-3187-3p	CLIP-seq
MIRT807524	hsa-miR-3194-3p	CLIP-seq
MIRT807525	hsa-miR-320a	CLIP-seq
MIRT807526	hsa-miR-320b	CLIP-seq
MIRT807527	hsa-miR-320c	CLIP-seq
MIRT807528	hsa-miR-320d	CLIP-seq
MIRT807529	hsa-miR-338-5p	CLIP-seq
MIRT807530	hsa-miR-340	CLIP-seq
MIRT807531	hsa-miR-34c-3p	CLIP-seq
MIRT807532	hsa-miR-3591-3p	CLIP-seq
MIRT807533	hsa-miR-3605-5p	CLIP-seq
MIRT807534	hsa-miR-3616-5p	CLIP-seq
MIRT807535	hsa-miR-3617	CLIP-seq
MIRT807536	hsa-miR-3619-3p	CLIP-seq
MIRT807537	hsa-miR-3647-3p	CLIP-seq
MIRT807538	hsa-miR-3647-5p	CLIP-seq
MIRT807539	hsa-miR-3653	CLIP-seq
MIRT807540	hsa-miR-3658	CLIP-seq
MIRT807541	hsa-miR-3666	CLIP-seq
MIRT807542	hsa-miR-3667-5p	CLIP-seq
MIRT807543	hsa-miR-3675-5p	CLIP-seq
MIRT807544	hsa-miR-3679-5p	CLIP-seq
MIRT807545	hsa-miR-374c	CLIP-seq
MIRT807546	hsa-miR-380	CLIP-seq
MIRT807547	hsa-miR-3913-3p	CLIP-seq
MIRT807548	hsa-miR-3920	CLIP-seq
MIRT807549	hsa-miR-3973	CLIP-seq
MIRT807550	hsa-miR-4262	CLIP-seq
MIRT807551	hsa-miR-4263	CLIP-seq
MIRT807552	hsa-miR-4277	CLIP-seq
MIRT807553	hsa-miR-4283	CLIP-seq
MIRT807554	hsa-miR-4293	CLIP-seq
MIRT807555	hsa-miR-4295	CLIP-seq
MIRT807556	hsa-miR-4307	CLIP-seq
MIRT807557	hsa-miR-4317	CLIP-seq
MIRT807558	hsa-miR-4429	CLIP-seq
MIRT807559	hsa-miR-4435	CLIP-seq
MIRT807560	hsa-miR-4436a	CLIP-seq
MIRT807561	hsa-miR-4453	CLIP-seq
MIRT807562	hsa-miR-4477a	CLIP-seq
MIRT807563	hsa-miR-4482	CLIP-seq
MIRT807564	hsa-miR-4489	CLIP-seq
MIRT807565	hsa-miR-4501	CLIP-seq
MIRT807566	hsa-miR-4502	CLIP-seq
MIRT807567	hsa-miR-4503	CLIP-seq
MIRT807568	hsa-miR-4509	CLIP-seq
MIRT807569	hsa-miR-452	CLIP-seq
MIRT807570	hsa-miR-4538	CLIP-seq
MIRT807571	hsa-miR-454	CLIP-seq
MIRT807572	hsa-miR-4635	CLIP-seq
MIRT807573	hsa-miR-4652-3p	CLIP-seq
MIRT807574	hsa-miR-4660	CLIP-seq
MIRT807575	hsa-miR-4661-5p	CLIP-seq
MIRT807576	hsa-miR-4675	CLIP-seq
MIRT807577	hsa-miR-4676-3p	CLIP-seq
MIRT807578	hsa-miR-4687-3p	CLIP-seq
MIRT807579	hsa-miR-4693-5p	CLIP-seq
MIRT807580	hsa-miR-4697-3p	CLIP-seq
MIRT807581	hsa-miR-4699-3p	CLIP-seq
MIRT807582	hsa-miR-4701-5p	CLIP-seq
MIRT807583	hsa-miR-4729	CLIP-seq
MIRT807584	hsa-miR-4740-5p	CLIP-seq
MIRT807585	hsa-miR-4741	CLIP-seq
MIRT807586	hsa-miR-4744	CLIP-seq
MIRT807587	hsa-miR-4773	CLIP-seq
MIRT807588	hsa-miR-4774-3p	CLIP-seq
MIRT807589	hsa-miR-4775	CLIP-seq
MIRT807590	hsa-miR-4799-5p	CLIP-seq
MIRT807591	hsa-miR-4803	CLIP-seq
MIRT807592	hsa-miR-499-3p	CLIP-seq
MIRT807593	hsa-miR-499a-3p	CLIP-seq
MIRT807594	hsa-miR-5047	CLIP-seq
MIRT807595	hsa-miR-518a-3p	CLIP-seq
MIRT807596	hsa-miR-518b	CLIP-seq
MIRT807597	hsa-miR-518c	CLIP-seq
MIRT807598	hsa-miR-518d-3p	CLIP-seq
MIRT807599	hsa-miR-518f	CLIP-seq
MIRT807600	hsa-miR-519a	CLIP-seq
MIRT807601	hsa-miR-519b-3p	CLIP-seq
MIRT807602	hsa-miR-519c-3p	CLIP-seq
MIRT807603	hsa-miR-519d	CLIP-seq
MIRT807604	hsa-miR-520g	CLIP-seq
MIRT807605	hsa-miR-520h	CLIP-seq
MIRT807606	hsa-miR-544b	CLIP-seq
MIRT807607	hsa-miR-548c-3p	CLIP-seq
MIRT807608	hsa-miR-548s	CLIP-seq
MIRT807609	hsa-miR-548u	CLIP-seq
MIRT807610	hsa-miR-571	CLIP-seq
MIRT807611	hsa-miR-573	CLIP-seq
MIRT807612	hsa-miR-576-5p	CLIP-seq
MIRT807613	hsa-miR-577	CLIP-seq
MIRT807614	hsa-miR-579	CLIP-seq
MIRT807615	hsa-miR-582-5p	CLIP-seq
MIRT807616	hsa-miR-588	CLIP-seq
MIRT807617	hsa-miR-591	CLIP-seq
MIRT807618	hsa-miR-641	CLIP-seq
MIRT807619	hsa-miR-648	CLIP-seq
MIRT807620	hsa-miR-653	CLIP-seq
MIRT807621	hsa-miR-655	CLIP-seq
MIRT807622	hsa-miR-767-3p	CLIP-seq
MIRT807623	hsa-miR-93	CLIP-seq
MIRT807624	hsa-miR-944	CLIP-seq
MIRT807487	hsa-miR-1224-3p	CLIP-seq
MIRT807488	hsa-miR-1225-5p	CLIP-seq
MIRT807489	hsa-miR-1260	CLIP-seq
MIRT807490	hsa-miR-1260b	CLIP-seq
MIRT807495	hsa-miR-1280	CLIP-seq
MIRT1938455	hsa-miR-1299	CLIP-seq
MIRT1938456	hsa-miR-144	CLIP-seq
MIRT807500	hsa-miR-150	CLIP-seq
MIRT1938457	hsa-miR-155	CLIP-seq
MIRT807513	hsa-miR-223	CLIP-seq
MIRT807521	hsa-miR-3152-5p	CLIP-seq
MIRT807524	hsa-miR-3194-3p	CLIP-seq
MIRT807529	hsa-miR-338-5p	CLIP-seq
MIRT807532	hsa-miR-3591-3p	CLIP-seq
MIRT807537	hsa-miR-3647-3p	CLIP-seq
MIRT1938458	hsa-miR-3682-3p	CLIP-seq
MIRT807548	hsa-miR-3920	CLIP-seq
MIRT1938459	hsa-miR-4264	CLIP-seq
MIRT807552	hsa-miR-4277	CLIP-seq
MIRT1938460	hsa-miR-431	CLIP-seq
MIRT1938461	hsa-miR-4424	CLIP-seq
MIRT1938462	hsa-miR-4452	CLIP-seq
MIRT807562	hsa-miR-4477a	CLIP-seq
MIRT807566	hsa-miR-4502	CLIP-seq
MIRT807569	hsa-miR-452	CLIP-seq
MIRT807575	hsa-miR-4661-5p	CLIP-seq
MIRT807577	hsa-miR-4676-3p	CLIP-seq
MIRT1938463	hsa-miR-4682	CLIP-seq
MIRT807579	hsa-miR-4693-5p	CLIP-seq
MIRT807580	hsa-miR-4697-3p	CLIP-seq
MIRT1938464	hsa-miR-4703-3p	CLIP-seq
MIRT1938465	hsa-miR-4711-5p	CLIP-seq
MIRT1938466	hsa-miR-4768-5p	CLIP-seq
MIRT807587	hsa-miR-4773	CLIP-seq
MIRT807588	hsa-miR-4774-3p	CLIP-seq
MIRT807589	hsa-miR-4775	CLIP-seq
MIRT807614	hsa-miR-579	CLIP-seq
MIRT807615	hsa-miR-582-5p	CLIP-seq
MIRT1938467	hsa-miR-590-3p	CLIP-seq
MIRT1938468	hsa-miR-640	CLIP-seq
MIRT1938469	hsa-miR-875-3p	CLIP-seq
MIRT1938470	hsa-miR-922	CLIP-seq
MIRT1938471	hsa-miR-935	CLIP-seq
MIRT807624	hsa-miR-944	CLIP-seq
MIRT2177812	hsa-miR-103a	CLIP-seq
MIRT807482	hsa-miR-106a	CLIP-seq
MIRT807483	hsa-miR-106b	CLIP-seq
MIRT2177813	hsa-miR-107	CLIP-seq
MIRT807485	hsa-miR-1197	CLIP-seq
MIRT807486	hsa-miR-1208	CLIP-seq
MIRT807487	hsa-miR-1224-3p	CLIP-seq
MIRT807488	hsa-miR-1225-5p	CLIP-seq
MIRT807489	hsa-miR-1260	CLIP-seq
MIRT807490	hsa-miR-1260b	CLIP-seq
MIRT807491	hsa-miR-1264	CLIP-seq
MIRT807494	hsa-miR-128	CLIP-seq
MIRT807495	hsa-miR-1280	CLIP-seq
MIRT2177814	hsa-miR-1283	CLIP-seq
MIRT1938455	hsa-miR-1299	CLIP-seq
MIRT807498	hsa-miR-130a	CLIP-seq
MIRT807499	hsa-miR-130b	CLIP-seq
MIRT2177815	hsa-miR-1323	CLIP-seq
MIRT2177816	hsa-miR-137	CLIP-seq
MIRT807500	hsa-miR-150	CLIP-seq
MIRT1938457	hsa-miR-155	CLIP-seq
MIRT807501	hsa-miR-17	CLIP-seq
MIRT807506	hsa-miR-197	CLIP-seq
MIRT807509	hsa-miR-20a	CLIP-seq
MIRT807510	hsa-miR-20b	CLIP-seq
MIRT807513	hsa-miR-223	CLIP-seq
MIRT2177817	hsa-miR-25	CLIP-seq
MIRT807514	hsa-miR-27a	CLIP-seq
MIRT807515	hsa-miR-27b	CLIP-seq
MIRT807516	hsa-miR-301a	CLIP-seq
MIRT807517	hsa-miR-301b	CLIP-seq
MIRT2177818	hsa-miR-3065-3p	CLIP-seq
MIRT2177819	hsa-miR-3074-3p	CLIP-seq
MIRT2177820	hsa-miR-30a	CLIP-seq
MIRT2177821	hsa-miR-30b	CLIP-seq
MIRT2177822	hsa-miR-30c	CLIP-seq
MIRT2177823	hsa-miR-30d	CLIP-seq
MIRT2177824	hsa-miR-30e	CLIP-seq
MIRT807518	hsa-miR-3117-3p	CLIP-seq
MIRT2177825	hsa-miR-3129-3p	CLIP-seq
MIRT807519	hsa-miR-3130-5p	CLIP-seq
MIRT807524	hsa-miR-3194-3p	CLIP-seq
MIRT2177826	hsa-miR-32	CLIP-seq
MIRT807529	hsa-miR-338-5p	CLIP-seq
MIRT807531	hsa-miR-34c-3p	CLIP-seq
MIRT807534	hsa-miR-3616-5p	CLIP-seq
MIRT807535	hsa-miR-3617	CLIP-seq
MIRT807536	hsa-miR-3619-3p	CLIP-seq
MIRT2177827	hsa-miR-363	CLIP-seq
MIRT807538	hsa-miR-3647-5p	CLIP-seq
MIRT807541	hsa-miR-3666	CLIP-seq
MIRT807542	hsa-miR-3667-5p	CLIP-seq
MIRT2177828	hsa-miR-367	CLIP-seq
MIRT807545	hsa-miR-374c	CLIP-seq
MIRT807547	hsa-miR-3913-3p	CLIP-seq
MIRT807549	hsa-miR-3973	CLIP-seq
MIRT2177829	hsa-miR-4272	CLIP-seq
MIRT807552	hsa-miR-4277	CLIP-seq
MIRT807555	hsa-miR-4295	CLIP-seq
MIRT807560	hsa-miR-4436a	CLIP-seq
MIRT807562	hsa-miR-4477a	CLIP-seq
MIRT807563	hsa-miR-4482	CLIP-seq
MIRT807565	hsa-miR-4501	CLIP-seq
MIRT807569	hsa-miR-452	CLIP-seq
MIRT807571	hsa-miR-454	CLIP-seq
MIRT2177830	hsa-miR-4639-3p	CLIP-seq
MIRT807577	hsa-miR-4676-3p	CLIP-seq
MIRT807579	hsa-miR-4693-5p	CLIP-seq
MIRT807580	hsa-miR-4697-3p	CLIP-seq
MIRT807587	hsa-miR-4773	CLIP-seq
MIRT807590	hsa-miR-4799-5p	CLIP-seq
MIRT807592	hsa-miR-499-3p	CLIP-seq
MIRT807593	hsa-miR-499a-3p	CLIP-seq
MIRT807600	hsa-miR-519a	CLIP-seq
MIRT807601	hsa-miR-519b-3p	CLIP-seq
MIRT807602	hsa-miR-519c-3p	CLIP-seq
MIRT807603	hsa-miR-519d	CLIP-seq
MIRT807604	hsa-miR-520g	CLIP-seq
MIRT807605	hsa-miR-520h	CLIP-seq
MIRT2177831	hsa-miR-548aa	CLIP-seq
MIRT2177832	hsa-miR-548o	CLIP-seq
MIRT2177833	hsa-miR-562	CLIP-seq
MIRT807611	hsa-miR-573	CLIP-seq
MIRT807614	hsa-miR-579	CLIP-seq
MIRT807615	hsa-miR-582-5p	CLIP-seq
MIRT807617	hsa-miR-591	CLIP-seq
MIRT1938468	hsa-miR-640	CLIP-seq
MIRT807618	hsa-miR-641	CLIP-seq
MIRT2177834	hsa-miR-642a	CLIP-seq
MIRT807620	hsa-miR-653	CLIP-seq
MIRT807621	hsa-miR-655	CLIP-seq
MIRT1938469	hsa-miR-875-3p	CLIP-seq
MIRT1938470	hsa-miR-922	CLIP-seq
MIRT2177835	hsa-miR-92a	CLIP-seq
MIRT2177836	hsa-miR-92b	CLIP-seq
MIRT807623	hsa-miR-93	CLIP-seq
MIRT1938471	hsa-miR-935	CLIP-seq
MIRT807624	hsa-miR-944	CLIP-seq
MIRT2177837	hsa-miR-95	CLIP-seq
MIRT807500	hsa-miR-150	CLIP-seq
MIRT807569	hsa-miR-452	CLIP-seq
MIRT807577	hsa-miR-4676-3p	CLIP-seq
MIRT807579	hsa-miR-4693-5p	CLIP-seq
MIRT807614	hsa-miR-579	CLIP-seq
MIRT2177829	hsa-miR-4272	CLIP-seq
MIRT1938460	hsa-miR-431	CLIP-seq
MIRT807562	hsa-miR-4477a	CLIP-seq
MIRT2426555	hsa-miR-4685-5p	CLIP-seq
MIRT2426556	hsa-miR-511	CLIP-seq
MIRT1938470	hsa-miR-922	CLIP-seq
MIRT2177837	hsa-miR-95	CLIP-seq
MIRT807486	hsa-miR-1208	CLIP-seq
MIRT807488	hsa-miR-1225-5p	CLIP-seq
MIRT2481175	hsa-miR-2117	CLIP-seq
MIRT807524	hsa-miR-3194-3p	CLIP-seq
MIRT807525	hsa-miR-320a	CLIP-seq
MIRT807526	hsa-miR-320b	CLIP-seq
MIRT807527	hsa-miR-320c	CLIP-seq
MIRT807528	hsa-miR-320d	CLIP-seq
MIRT2481176	hsa-miR-3613-3p	CLIP-seq
MIRT807536	hsa-miR-3619-3p	CLIP-seq
MIRT807537	hsa-miR-3647-3p	CLIP-seq
MIRT1938458	hsa-miR-3682-3p	CLIP-seq
MIRT807545	hsa-miR-374c	CLIP-seq
MIRT807547	hsa-miR-3913-3p	CLIP-seq
MIRT2481177	hsa-miR-4426	CLIP-seq
MIRT807558	hsa-miR-4429	CLIP-seq
MIRT807560	hsa-miR-4436a	CLIP-seq
MIRT807566	hsa-miR-4502	CLIP-seq
MIRT2481178	hsa-miR-4647	CLIP-seq
MIRT2481179	hsa-miR-4662b	CLIP-seq
MIRT1938464	hsa-miR-4703-3p	CLIP-seq
MIRT2481180	hsa-miR-4753-3p	CLIP-seq
MIRT2481181	hsa-miR-489	CLIP-seq
MIRT807609	hsa-miR-548u	CLIP-seq
MIRT807613	hsa-miR-577	CLIP-seq
MIRT807617	hsa-miR-591	CLIP-seq
MIRT1938468	hsa-miR-640	CLIP-seq
MIRT2481182	hsa-miR-643	CLIP-seq
MIRT807621	hsa-miR-655	CLIP-seq
MIRT807486	hsa-miR-1208	CLIP-seq
MIRT807488	hsa-miR-1225-5p	CLIP-seq
MIRT2675649	hsa-miR-1253	CLIP-seq
MIRT2481175	hsa-miR-2117	CLIP-seq
MIRT2675650	hsa-miR-3185	CLIP-seq
MIRT807524	hsa-miR-3194-3p	CLIP-seq
MIRT807525	hsa-miR-320a	CLIP-seq
MIRT807526	hsa-miR-320b	CLIP-seq
MIRT807527	hsa-miR-320c	CLIP-seq
MIRT807528	hsa-miR-320d	CLIP-seq
MIRT2481176	hsa-miR-3613-3p	CLIP-seq
MIRT807536	hsa-miR-3619-3p	CLIP-seq
MIRT807537	hsa-miR-3647-3p	CLIP-seq
MIRT1938458	hsa-miR-3682-3p	CLIP-seq
MIRT807545	hsa-miR-374c	CLIP-seq
MIRT807547	hsa-miR-3913-3p	CLIP-seq
MIRT2675651	hsa-miR-3927	CLIP-seq
MIRT807549	hsa-miR-3973	CLIP-seq
MIRT2675652	hsa-miR-4311	CLIP-seq
MIRT2481177	hsa-miR-4426	CLIP-seq
MIRT807558	hsa-miR-4429	CLIP-seq
MIRT807560	hsa-miR-4436a	CLIP-seq
MIRT807566	hsa-miR-4502	CLIP-seq
MIRT2481178	hsa-miR-4647	CLIP-seq
MIRT2481179	hsa-miR-4662b	CLIP-seq
MIRT1938464	hsa-miR-4703-3p	CLIP-seq
MIRT2481180	hsa-miR-4753-3p	CLIP-seq
MIRT2481181	hsa-miR-489	CLIP-seq
MIRT807604	hsa-miR-520g	CLIP-seq
MIRT807605	hsa-miR-520h	CLIP-seq
MIRT807609	hsa-miR-548u	CLIP-seq
MIRT807613	hsa-miR-577	CLIP-seq
MIRT807617	hsa-miR-591	CLIP-seq
MIRT1938468	hsa-miR-640	CLIP-seq
MIRT2481182	hsa-miR-643	CLIP-seq
MIRT807621	hsa-miR-655	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001772	Component	Immunological synapse	IEA
GO:0001772	Component	Immunological synapse	ISS
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001818	Process	Negative regulation of cytokine production	ISS
GO:0003056	Process	Regulation of vascular associated smooth muscle contraction	IEA
GO:0003056	Process	Regulation of vascular associated smooth muscle contraction	ISS
GO:0005388	Function	P-type calcium transporter activity	IBA
GO:0005388	Function	P-type calcium transporter activity	IEA
GO:0005388	Function	P-type calcium transporter activity	TAS	8396145
GO:0005515	Function	Protein binding	IPI	12763866, 18029012, 22084111, 30126976, 30190470
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18029012
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8396145
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0015085	Function	Calcium ion transmembrane transporter activity	IDA	18029012
GO:0015085	Function	Calcium ion transmembrane transporter activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016887	Function	ATP hydrolysis activity	IDA	30190470
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	ISS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	TAS
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042734	Component	Presynaptic membrane	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	18029012
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IEA
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IEA
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IMP	29104511
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	ISS
GO:0051928	Process	Positive regulation of calcium ion transport	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098684	Component	Photoreceptor ribbon synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140678	Function	Molecular function inhibitor activity	IDA	30190470
GO:1900076	Process	Regulation of cellular response to insulin stimulus	IMP	29104511
GO:1903779	Process	Regulation of cardiac conduction	IEA
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1990034	Process	Calcium ion export across plasma membrane	IDA	18029012

Other IDs

• MIM: 108731
• HGNC: 814
• e!Ensembl: ENSG00000070961

Protein

• UniProt ID: P20020
• Protein name: Plasma membrane calcium-transporting ATPase 1 (EC 7.2.2.10) (Plasma membrane calcium ATPase isoform 1) (PMCA1) (Plasma membrane calcium pump isoform 1)
• Protein function: Catalyzes the hydrolysis of ATP coupled with the transport of calcium from the cytoplasm to the extracellular space thereby maintaining intracellular calcium homeostasis (PubMed:35358416). Plays a role in blood pressure regulation through regula
• PDB: 6A69
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00690	Cation_ATPase_N	51 → 121	Cation transporter/ATPase, N-terminus	Domain
  PF00122	E1-E2_ATPase	189 → 307		Family
  PF00122	E1-E2_ATPase	347 → 453		Family
  PF13246	Cation_ATPase	482 → 614		Family
  PF00702	Hydrolase	658 → 809		Domain
  PF00689	Cation_ATPase_C	879 → 1061	Cation transporting ATPase, C-terminus	Family
  PF12424	ATP_Ca_trans_C	1103 → 1149	Plasma membrane calcium transporter ATPase C terminal	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform B: Ubiquitously expressed. Isoform C: Found in brain cortex, skeletal muscle and heart muscle. Isoform D: Has only been found in fetal skeletal muscle. Isoform K: Found in small intestine and liver. Abundantly expressed in the
• Sequence:

  MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
  TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
  SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
  FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
  SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
  KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
  VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
  IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
  TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
  VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
  KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
  EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
  KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
  IDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
  AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
  ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
  NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
  IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
  IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSS
  IHNFMTHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEM
  NKSATSSSPGSPLHSLETSL

• Sequence length: 1220

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
ATP2B1-related disorder	Likely pathogenic	rs2540804470	RCV003397499	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Clubfoot	Likely pathogenic	rs2135942244, rs370810713	RCV002266029 RCV002266030	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypocalcemia	Likely pathogenic	rs2135942244, rs370810713	RCV002266029 RCV002266030	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual developmental disorder, autosomal dominant 66	Likely pathogenic; Pathogenic	rs2136192267, rs2136158725, rs2136106360, rs1033577592, rs2136193860, rs2136050284, rs1883642606, rs2540804225, rs1879993052	RCV002260718 RCV002260719 RCV002260720 RCV002260721 RCV002260722 RCV002294523 RCV003387661 RCV003484444 RCV004762034	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability, autosomal dominant 30	Likely pathogenic	rs1876205424	RCV003330165	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Isolated Pierre-Robin syndrome	Likely pathogenic	rs2135942244, rs370810713	RCV002266029 RCV002266030	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Likely pathogenic	rs2135942244, rs370810713	RCV002266029 RCV002266030	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic; Pathogenic	rs2136192267, rs2136158725, rs2136106360, rs2135949570, rs1033577592, rs2136193860, rs1879711772, rs2540763693, rs1879993052	RCV002226602 RCV002226603 RCV002226604 RCV002226606 RCV002226608 RCV002226609 RCV002226610 RCV003389188 RCV001262498	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Periventricular nodular heterotopia	Likely pathogenic	rs2135942244, rs370810713	RCV002266029 RCV002266030	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CLUBFOOT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, AUTOSOMAL DOMINANT 30, WITH SPEECH DELAY AND BEHAVIORAL ABNORMALITIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31819190		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29902063		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29902063		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29902063	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	35358416	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12359307		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35031021	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	CTD_human_DG	15003327		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	36207321	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31173308		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31173308	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35194111, 37629096	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29490945		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	22751097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29902063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	22751097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	25385345, 26534935, 29902063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	25740055, 26534935, 29902063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975, 29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	23727086	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282, 22751097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	22751097, 27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	29902063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cryptorchidism	Cryptorchidism	LHGDN	16933204		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35358416	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29104511		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	34935307	Inhibit	★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	21868014	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	31858526	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37666951	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	10425217, 23324996, 26933664, 31242870, 9020386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	26933664, 31242870, 32555714	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial benign hypercalcemia	Hypocalciuric hypercalcemia	BEFREE	3160102		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36207321	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	33760199	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Diseases	Hematologic disease	Pubtator	36718908	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29104511		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	35358416, 36207321	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	20921432, 23727086, 25385345, 26933664, 27149052, 28851949, 29902063, 29982197, 31242870, 31858526, 37175507, 39684400	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	33760199	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	10425217, 19960030, 20414254, 20479155, 20921432, 21633377, 22229515, 22476231, 23079715, 23324996, 23591986, 23727086, 23759979, 24142389, 26933664, 27149052, 28795531, 28851949, 28934190, 29046519, 29902063, 29950683, 31242870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	GWASCAT_DG	19430479, 25249183, 28273873, 30487518, 31513605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	19430479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	GWASDB_DG	19430479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	12359307		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29490945		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15911623		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23727086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	23727086	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	26343387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	25385345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	25385345	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	22733819	Inhibit	★☆☆☆☆ Found in Text Mining only
Pseudoaphakia	Cataract	CTD_human_DG	15003327		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37176017	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12082533		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	35358416	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36793271	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	29902063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular disease	Pubtator	34935307	Associate	★☆☆☆☆ Found in Text Mining only