ASRGL1 (asparaginase and isoaspartyl peptidase 1)

Gene

• Entrez ID: 80150
• Gene name: Asparaginase and isoaspartyl peptidase 1
• Gene symbol: ASRGL1
• Synonyms (NCBI Gene): ALP, ALP1, CRASH
• Chromosome: 11
• Chromosome location: 11q12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024570	hsa-miR-215-5p	Microarray	19074876
MIRT026301	hsa-miR-192-5p	Microarray	19074876
MIRT030736	hsa-miR-21-5p	Microarray	18591254
MIRT803198	hsa-miR-1	CLIP-seq
MIRT803199	hsa-miR-129-5p	CLIP-seq
MIRT803200	hsa-miR-206	CLIP-seq
MIRT803201	hsa-miR-224	CLIP-seq
MIRT803202	hsa-miR-3154	CLIP-seq
MIRT803203	hsa-miR-3673	CLIP-seq
MIRT803204	hsa-miR-3918	CLIP-seq
MIRT803205	hsa-miR-3919	CLIP-seq
MIRT803206	hsa-miR-4321	CLIP-seq
MIRT803207	hsa-miR-4446-3p	CLIP-seq
MIRT803208	hsa-miR-4512	CLIP-seq
MIRT803209	hsa-miR-4539	CLIP-seq
MIRT803210	hsa-miR-4656	CLIP-seq
MIRT803211	hsa-miR-4717-3p	CLIP-seq
MIRT803212	hsa-miR-4728-3p	CLIP-seq
MIRT803213	hsa-miR-4756-3p	CLIP-seq
MIRT803214	hsa-miR-4802-3p	CLIP-seq
MIRT803215	hsa-miR-613	CLIP-seq
MIRT803216	hsa-miR-628-5p	CLIP-seq
MIRT1937206	hsa-miR-1299	CLIP-seq
MIRT1937207	hsa-miR-4666-3p	CLIP-seq
MIRT1937208	hsa-miR-621	CLIP-seq
MIRT1937209	hsa-miR-875-3p	CLIP-seq
MIRT2176863	hsa-miR-122	CLIP-seq
MIRT2176864	hsa-miR-1297	CLIP-seq
MIRT1937206	hsa-miR-1299	CLIP-seq
MIRT2176865	hsa-miR-26a	CLIP-seq
MIRT2176866	hsa-miR-26b	CLIP-seq
MIRT2176867	hsa-miR-3124-3p	CLIP-seq
MIRT2176868	hsa-miR-3135b	CLIP-seq
MIRT2176869	hsa-miR-3180-5p	CLIP-seq
MIRT2176870	hsa-miR-3652	CLIP-seq
MIRT2176871	hsa-miR-3660	CLIP-seq
MIRT2176872	hsa-miR-378g	CLIP-seq
MIRT2176873	hsa-miR-4293	CLIP-seq
MIRT2176874	hsa-miR-4423-5p	CLIP-seq
MIRT2176875	hsa-miR-4430	CLIP-seq
MIRT2176876	hsa-miR-4437	CLIP-seq
MIRT2176877	hsa-miR-4465	CLIP-seq
MIRT2176878	hsa-miR-4526	CLIP-seq
MIRT1937207	hsa-miR-4666-3p	CLIP-seq
MIRT2176879	hsa-miR-4674	CLIP-seq
MIRT2176880	hsa-miR-4792	CLIP-seq
MIRT2176881	hsa-miR-500a	CLIP-seq
MIRT2176882	hsa-miR-520a-5p	CLIP-seq
MIRT2176883	hsa-miR-525-5p	CLIP-seq
MIRT2176884	hsa-miR-548ad	CLIP-seq
MIRT1937208	hsa-miR-621	CLIP-seq
MIRT1937209	hsa-miR-875-3p	CLIP-seq
MIRT803198	hsa-miR-1	CLIP-seq
MIRT2176863	hsa-miR-122	CLIP-seq
MIRT2480289	hsa-miR-149	CLIP-seq
MIRT803200	hsa-miR-206	CLIP-seq
MIRT2176868	hsa-miR-3135b	CLIP-seq
MIRT2176870	hsa-miR-3652	CLIP-seq
MIRT803203	hsa-miR-3673	CLIP-seq
MIRT803206	hsa-miR-4321	CLIP-seq
MIRT2176874	hsa-miR-4423-5p	CLIP-seq
MIRT2176875	hsa-miR-4430	CLIP-seq
MIRT803211	hsa-miR-4717-3p	CLIP-seq
MIRT803214	hsa-miR-4802-3p	CLIP-seq
MIRT803215	hsa-miR-613	CLIP-seq
MIRT803198	hsa-miR-1	CLIP-seq
MIRT2480289	hsa-miR-149	CLIP-seq
MIRT803200	hsa-miR-206	CLIP-seq
MIRT2675537	hsa-miR-24	CLIP-seq
MIRT2675538	hsa-miR-3591-3p	CLIP-seq
MIRT2675539	hsa-miR-3612	CLIP-seq
MIRT803203	hsa-miR-3673	CLIP-seq
MIRT2675540	hsa-miR-4284	CLIP-seq
MIRT803206	hsa-miR-4321	CLIP-seq
MIRT2675541	hsa-miR-4443	CLIP-seq
MIRT803211	hsa-miR-4717-3p	CLIP-seq
MIRT803214	hsa-miR-4802-3p	CLIP-seq
MIRT2675542	hsa-miR-485-5p	CLIP-seq
MIRT803215	hsa-miR-613	CLIP-seq
MIRT2675543	hsa-miR-650	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0001917	Component	Photoreceptor inner segment	ISS
GO:0003948	Function	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	IDA	19839645
GO:0004067	Function	Asparaginase activity	IDA	19839645
GO:0004067	Function	Asparaginase activity	IEA
GO:0004067	Function	Asparaginase activity	IMP	27106100
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	27106100
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008798	Function	Beta-aspartyl-peptidase activity	IDA	19839645
GO:0008798	Function	Beta-aspartyl-peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0033345	Process	L-asparagine catabolic process via L-aspartate	IBA
GO:0033345	Process	L-asparagine catabolic process via L-aspartate	IDA	19839645
GO:0033345	Process	L-asparagine catabolic process via L-aspartate	ISS

Other IDs

• MIM: 609212
• HGNC: 16448
• e!Ensembl: ENSG00000162174

Protein

• UniProt ID: Q7L266
• Protein name: Isoaspartyl peptidase/L-asparaginase (EC 3.4.19.5) (EC 3.5.1.1) (Asparaginase-like protein 1) (Beta-aspartyl-peptidase) (Isoaspartyl dipeptidase) (L-asparagine amidohydrolase) [Cleaved into: Isoaspartyl peptidase/L-asparaginase alpha chain; Isoaspartyl pe
• Protein function: Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has ca
• PDB: 3TKJ, 4ET0, 4O0C, 4O0D, 4O0E, 4O0F, 4O0G, 4O0H, 4OSX, 4OSY, 4PVP, 4PVQ, 4PVR, 4PVS, 4ZM9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01112	Asparaginase_2	3 → 296	Asparaginase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, kidney, testis and tissues of the gastrointestinal tract. Present in sperm (at protein level). Over-expressed in uterine, mammary, prostatic and ovarian carcinoma. {ECO:0000269|PubMed:11984834, ECO:0000269|PubMed:14
• Sequence:

  MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPE
  FNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQ
  GAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNV
  AYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQ
  GKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPD
  DTTITDLP

• Sequence length: 308

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASRGL1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal dystrophy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	29895074		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	19635183		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10029588, 11415466, 12433682, 12518376, 14712291, 14724653, 15665306, 15718422, 15837750, 16156856, 16497975, 19124805, 20494936, 22042278, 22185211, 24033105, 24297177, 24659632, 25079173, 25090024, 25626693, 25697915, 25740072, 26180806, 26457809, 26694875, 26867931, 26878238, 26928249, 27253887, 27813440, 28060110, 28150907, 28346428, 28355969, 28650467, 28728499, 28801829, 28851634, 28860480, 28884068, 28982056, 29079538, 29127643, 29299118, 29343523, 29454679, 29550241, 30055974, 30061420, 30139388, 30488741, 30511621, 30597637, 30634463, 30689137, 30753228, 30762133, 30813054, 30819925, 30826572, 30917738, 30938058, 31030380, 31104099, 31491643, 31516343, 31523835, 31552479, 31556233, 31612474, 31659118, 6603258		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	26154683		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29697579, 31470743		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10029588, 12433682, 12518376, 14712291, 15665306, 15718422, 15837750, 16497975, 19124805, 22185211, 24297177, 25079173, 25090024, 28060110, 28150907, 28346428, 28355969, 28650467, 28801829, 28860480, 28884068, 29127643, 29299118, 29343523, 29550241, 30055974, 30061420, 30597637, 30634463, 30688831, 30753228, 30813054, 30819925, 30938058, 31104099, 31491643, 31516343, 31556233, 31659118		★☆☆☆☆ Found in Text Mining only
Adult hypophosphatasia (disorder)	Hypophosphatasia	BEFREE	15629439		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30290707, 31690171		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29880011, 30415492		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36012429	Associate	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	30544396	Associate	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	30599794		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	27434016		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29985230		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	27881006		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30728842		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	30123093		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14654938, 28900285, 30706358		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29767260	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30696738, 36572570	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19414332		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36572570	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20804919, 28835603, 29683727, 30274116		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18852115, 22333033		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31302425		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29223554		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29767260		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29767260		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10029588, 10643153, 10910927, 12433682, 12518376, 14712291, 15665306, 15718422, 15837750, 15899912, 16302217, 16497975, 19124805, 22185211, 22542578, 24297177, 25079173, 25090024, 25573381, 27555294, 28060110, 28150907, 28346428, 28355969, 28650467, 28801829, 28860480, 28884068, 29127643, 29236701, 29299118, 29343523, 29360413, 29550241, 30055974, 30061420, 30597637, 30634463, 30753228, 30813054, 30819925, 30938058, 31090597, 31104099, 31491643, 31516343, 31556233, 31659118		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	29299118		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	28267673		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	BEFREE	31117415		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	2745460		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19635183		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30125307		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30879693		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14654938, 25037223, 9221854		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33646276, 34850851	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30858360		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36769302	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	19373952		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27806633		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24909115, 25241253		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29454679		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31088856		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	24276437		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28454919, 31658881, 31671940		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	29486992		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	28459279	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29096882, 29486992, 29989298		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	11121210		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31010354		★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	BEFREE	28675023		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25919795, 29174446		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	2745460		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29605274, 30193917		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	19373952		★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	30061947		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	30655881		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	31838773		★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	17395561, 26797772, 28436937, 30289311, 31146036		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30290707		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	8556302		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	17395561, 28687737		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	6454771		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	17849043, 28917868, 9264396		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	28687737, 30289299		★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	18661088, 3665125		★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	28675023		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	18661088		★☆☆☆☆ Found in Text Mining only
Hypophosphatasia	Hypophosphatasia	BEFREE	10451522, 10679946, 24022022, 2605956, 2705456, 28000043, 28436937, 30289311, 3174660, 8964842		★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	BEFREE	8556302		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28904006		★☆☆☆☆ Found in Text Mining only
Infantile hypophosphatasia	Hypophosphatasia	BEFREE	12412800, 15660230		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17294222		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	18661088		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	28808392		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31760208		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11485552, 12168812, 27155523, 27885727, 28424408, 28505420, 28916825, 30381299, 30426897, 31209181, 6454771, 9490695		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24362429, 30052638	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30052638	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20804919, 23016580, 24014241, 26154683, 28224619, 29159986, 29299118, 31044436		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	20804919		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21834755, 23764751, 25369784, 26753954		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30125307		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31838773		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	30061947		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23768637, 25626693, 28851634, 30426897		★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	BEFREE	26694875		★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	29368155, 30464606		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	20804919		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	28851634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14654938, 19414332, 28900285, 30706358		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29096882		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31117415		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28835603, 29683727, 30274116		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17088436, 18852115, 22333033		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18976018, 31028291		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21106986, 23016580, 24033105, 25482130, 27539155, 28150907, 29872609, 30266308, 30573733, 30634463, 30993718, 31215369, 31523835, 31537817		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29767260		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14654938, 25037223, 9221854		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29605274		★☆☆☆☆ Found in Text Mining only
MASA SYNDROME (disorder)	MASA syndrome	BEFREE	17294222		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17294222		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27268090		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32915979	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	11238905		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12951057		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	31837116		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	21549096		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	21549096		★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	22675173, 23768637, 28034070, 28404973, 29602763, 29712887, 29760798, 31296577, 31517553		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10959091, 14654938, 24014241, 25119103, 29299118, 29761078, 31523835		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	17395561		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31690171		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26270641, 29964102		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30216123		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	18661088, 28620614, 29786747, 30338786, 30638953, 31452264		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28122543		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18852115, 22333033		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29767260	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27555294		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	30052638	Stimulate	★☆☆☆☆ Found in Text Mining only
Pleomorphic Lipoma	Lipoma	BEFREE	10959091		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30635633		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12518376, 15665306, 20494936, 22042278, 22185211, 24033105, 24659632, 25697915, 26180806, 26694875, 26867931, 26928249, 27253887, 27813440, 28728499, 28851634, 28982056, 29079538, 29454679, 30139388, 30488741, 30689137, 30762133, 30826572, 30917738, 31523835, 6603258		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17854304, 28003999		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	14687829, 29193593, 31714880		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31028291		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28904006		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	30864863		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24909115, 25241253		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12846052, 30864863		★☆☆☆☆ Found in Text Mining only
Sagittal craniosynostosis	Sagittal craniosynostosis	BEFREE	25753363		★☆☆☆☆ Found in Text Mining only
Scaphycephaly	Scaphocephaly	BEFREE	25753363		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	7564509		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31010354		★☆☆☆☆ Found in Text Mining only
Subcortical Band Heterotopia	Subcortical Band Heterotopia	BEFREE	30643535		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28188133, 28215935, 28675023, 31764026		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	20546854, 29703491, 31556233		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29434187		★☆☆☆☆ Found in Text Mining only
TROPICAL CALCIFIC PANCREATITIS	TROPICAL CALCIFIC PANCREATITIS	BEFREE	29269312		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	25736332		★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	28808392		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29767260	Associate	★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	30599794		★☆☆☆☆ Found in Text Mining only