ASB9 (ankyrin repeat and SOCS box containing 9)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 140462
• Gene name: Ankyrin repeat and SOCS box containing 9
• Gene symbol: ASB9
• Synonyms (NCBI Gene): -
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: This gene encodes a member of the ankyrin repeat and suppressor of cytokine signaling (SOCS) box protein family. Members of this family can interact with the elongin B-C adapter complex via their SOCS box domain and further complex with the cullin and rin

miRNA Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1936963	hsa-miR-1294	CLIP-seq
MIRT1936964	hsa-miR-3130-5p	CLIP-seq
MIRT1936965	hsa-miR-3148	CLIP-seq
MIRT1936966	hsa-miR-3616-3p	CLIP-seq
MIRT1936967	hsa-miR-4316	CLIP-seq
MIRT1936968	hsa-miR-4482	CLIP-seq
MIRT1936969	hsa-miR-4677-3p	CLIP-seq
MIRT1936970	hsa-miR-4687-3p	CLIP-seq
MIRT1936971	hsa-miR-4721	CLIP-seq
MIRT2176760	hsa-miR-1264	CLIP-seq
MIRT1936963	hsa-miR-1294	CLIP-seq
MIRT2176761	hsa-miR-136	CLIP-seq
MIRT2176762	hsa-miR-1909	CLIP-seq
MIRT2176763	hsa-miR-3117-5p	CLIP-seq
MIRT2176764	hsa-miR-3129-3p	CLIP-seq
MIRT1936964	hsa-miR-3130-5p	CLIP-seq
MIRT1936965	hsa-miR-3148	CLIP-seq
MIRT1936966	hsa-miR-3616-3p	CLIP-seq
MIRT2176765	hsa-miR-369-3p	CLIP-seq
MIRT2176766	hsa-miR-4297	CLIP-seq
MIRT1936967	hsa-miR-4316	CLIP-seq
MIRT1936968	hsa-miR-4482	CLIP-seq
MIRT2176767	hsa-miR-4639-3p	CLIP-seq
MIRT2176768	hsa-miR-4668-5p	CLIP-seq
MIRT1936969	hsa-miR-4677-3p	CLIP-seq
MIRT1936970	hsa-miR-4687-3p	CLIP-seq
MIRT1936971	hsa-miR-4721	CLIP-seq
MIRT2176769	hsa-miR-532-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 20211142, 21516116, 25416956, 25814554, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	17148442
GO:0016567	Process	Protein ubiquitination	IEA
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	23837592, 32513959, 33268465
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	25654263, 33268465
GO:0045732	Process	Positive regulation of protein catabolic process	IBA
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	17148442
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	25654263, 33268465
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IEA

Other IDs

• MIM: 300890
• HGNC: 17184
• e!Ensembl: ENSG00000102048

Protein

• UniProt ID: Q96DX5
• Protein name: Ankyrin repeat and SOCS box protein 9 (ASB-9)
• Protein function: Substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:25654263, PubMed:3
• PDB: 3D9H , 3ZKJ , 3ZNG , 6V9H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07525	SOCS_box	255 → 293	SOCS box	Domain
  PF12796	Ank_2	40 → 132	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	138 → 229	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	96 → 166	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	20 → 99	Ankyrin repeats (3 copies)	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in testis, kidney, and liver. {ECO:0000269|PubMed:20302626}.
• Sequence:

  MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGW
  AVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNL
  LLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQR
  ACVKKLLESGADVNQGKGQDSPLHAVARTASEELACLLMDFGADTQAKNAEGKRPVELVP
  PESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL

• Sequence length: 294

Pathways

Reactome Pathway

Neddylation

Antigen processing: Ubiquitination & Proteasome degradation

Related Genes

No strongly related genes found yet for ASB9.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ASB9.