ASB14 (ankyrin repeat and SOCS box containing 14)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 142686
Gene name Ankyrin repeat and SOCS box containing 14
Gene symbol ASB14
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3p14.3
Summary The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) protein
miRNA miRNA information provided by mirtarbase database.
17 Show/Hide all (17)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT802163 hsa-miR-188-5p CLIP-seq
MIRT802164 hsa-miR-204 CLIP-seq
MIRT802165 hsa-miR-211 CLIP-seq
MIRT802166 hsa-miR-3151 CLIP-seq
MIRT802167 hsa-miR-4447 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0016567 Process Protein ubiquitination IEA
GO:0035556 Process Intracellular signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NK59
Protein name Ankyrin repeat and SOCS box protein 14 (ASB-14)
Protein function May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Plays a role in the inh
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00023 Ank 117 → 149 Ankyrin repeat Repeat
PF07525 SOCS_box 531 → 572 SOCS box Domain
PF12796 Ank_2 155 → 248 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 253 → 343 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 340 → 416 Ankyrin repeats (3 copies) Repeat
Sequence 
MDNYTSDEDIDEDFDTQLIIQQSLQDIYKPGTAQHAPKDESLHSFLSADYKKIVETIEKV
GKEDALSHLTKYHSAFGEADEIGWIPLHKAAVQLNRKILEITLSASDPSLWEQTTHNGET
PLFLAVSSCLLENATFLLLNGCNPNAKNFEGNSPLLAAVLRDCYDMAALLINYGADVNLR
CANERTALHEAAKLGREDMVKLMLVSGAHPDPQSTYGFTPLALAAQSGHTEIMEMLLRKG
KIFCLASDSSSILLEAASGGNPDAVALLLEYGADANIPKNSGHLPIHVAADRGHLLALKI
LIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLDQRINKHYDDHRKSAL
YFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNP
LHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTKFCE
VITLSWLQHLSGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIHFILTNPRSLKHLCRL
KIRKCMGRLHLRCPVFMSFLPLPNRLKAYVLYKEYDLYGQGIFTGTW
Sequence length 587
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Neddylation
Antigen processing: Ubiquitination & Proteasome degradation

No strongly related genes found yet for ASB14.

No additional diseases found yet through genes similar to ASB14.