ART5 (ADP-ribosyltransferase 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 116969
Gene name ADP-ribosyltransferase 5
Gene symbol ART5
Synonyms (NCBI Gene)
ARTC5
Chromosome 11
Chromosome location 11p15.4
Summary The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolo
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT037668 hsa-miR-744-5p CLASH 23622248
MIRT801461 hsa-miR-2110 CLIP-seq
MIRT801462 hsa-miR-3150a-3p CLIP-seq
MIRT801463 hsa-miR-3175 CLIP-seq
MIRT801464 hsa-miR-4434 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003950 Function NAD+ poly-ADP-ribosyltransferase activity IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0016740 Function Transferase activity IEA
GO:0016757 Function Glycosyltransferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610625 24049 ENSG00000167311
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96L15
Protein name Ecto-ADP-ribosyltransferase 5 (EC 2.4.2.31) (ADP-ribosyltransferase C2 and C3 toxin-like 5) (ARTC5) (Mono(ADP-ribosyl)transferase 5) (NAD(P)(+)--arginine ADP-ribosyltransferase 5)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01129 ART 28 → 254 NAD:arginine ADP-ribosyltransferase Family
Sequence 
MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAH
HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGS
RELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQ
FASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGA
QSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMTKRHLQQP
Sequence length 291
Interactions View interactions

No strongly related genes found yet for ART5.

No additional diseases found yet through genes similar to ART5.