ARRDC1-AS1 (ARRDC1 antisense RNA 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 85026 |
| Gene name | ARRDC1 antisense RNA 1 |
| Gene symbol | ARRDC1-AS1 |
| Synonyms (NCBI Gene) |
C9orf37
|
| Chromosome | 9 |
| Chromosome location | 9q34.3 |
| Summary | This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9H2J1 |
| Protein name | Uncharacterized protein ARRDC1-AS1 (ARRDC1 antisense RNA 1) (ARRDC1 antisense gene protein 1) |
| Family and domains | |
| Sequence |
MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALK |
| Sequence length | 176 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ARRDC1-AS1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ARRDC1-AS1 (see Related Genes above), that are NOT already directly curated for ARRDC1-AS1 itself -- a lead worth checking, not a confirmed association.
0
|
|