Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	64860
Gene name	Armadillo repeat containing X-linked 5
Gene symbol	ARMCX5
Synonyms (NCBI Gene)	GASP5
Chromosome	X
Chromosome location	Xq22.1

31 Show/Hide all (31)

miRTarBase ID	miRNA	Experiments
MIRT799368	hsa-miR-3065-3p	CLIP-seq
MIRT799369	hsa-miR-3148	CLIP-seq
MIRT799370	hsa-miR-3152-5p	CLIP-seq
MIRT799371	hsa-miR-3163	CLIP-seq
MIRT799372	hsa-miR-3688-3p	CLIP-seq
MIRT799373	hsa-miR-4282	CLIP-seq
MIRT799374	hsa-miR-4452	CLIP-seq
MIRT799375	hsa-miR-4469	CLIP-seq
MIRT799376	hsa-miR-4695-3p	CLIP-seq
MIRT799377	hsa-miR-4705	CLIP-seq
MIRT799378	hsa-miR-4802-3p	CLIP-seq
MIRT799379	hsa-miR-4803	CLIP-seq
MIRT799380	hsa-miR-513c	CLIP-seq
MIRT799381	hsa-miR-514b-5p	CLIP-seq
MIRT799382	hsa-miR-548c-3p	CLIP-seq
MIRT799383	hsa-miR-570	CLIP-seq
MIRT799384	hsa-miR-21	CLIP-seq
MIRT799385	hsa-miR-298	CLIP-seq
MIRT799386	hsa-miR-361-5p	CLIP-seq
MIRT799387	hsa-miR-3664-3p	CLIP-seq
MIRT799388	hsa-miR-3678-3p	CLIP-seq
MIRT799389	hsa-miR-4528	CLIP-seq
MIRT799390	hsa-miR-510	CLIP-seq
MIRT799391	hsa-miR-512-5p	CLIP-seq
MIRT799392	hsa-miR-550b	CLIP-seq
MIRT799393	hsa-miR-590-5p	CLIP-seq
MIRT799394	hsa-miR-664	CLIP-seq
MIRT799386	hsa-miR-361-5p	CLIP-seq
MIRT799389	hsa-miR-4528	CLIP-seq
MIRT799394	hsa-miR-664	CLIP-seq
MIRT799386	hsa-miR-361-5p	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053

MIM	HGNC	e!Ensembl
301047	25772	ENSG00000125962

Q6P1M9

Protein name

Armadillo repeat-containing X-linked protein 5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04826	Arm_2	298 → 552	Armadillo-like	Family

Sequence

MVDSGTEARARGKAEAGLQDGISGPATARVNGKTQAEAVAEAELKTESVTQAKAGDGAMT
RTHTVTYREAMAVTREVIKVEDTTKTRVMVETKTKPLAERSIVPQTKSKAMPMSRVSTVT
KSEVKVVAVIEANIRSYAKSHDKANTGSRPDRREETSIGMKSSDEDEENICSWFWTGEEP
SVGSWFWPEEETSLQVYKPLPKIQEKPKPTHKPTLTIKQKVIAWSRARYIVLVPVEGGEQ
SLPPEGNWTLVETLIETPLGIRPLTKIPPYHGPYYQTLAEIKKQIRQREKYGPNPKACHC
KSRGFSLEPKEFDKLVALLKLTKDPFIHEIATMIMGISPAYPFTQDIIHDVGITVMIENL
VNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQLAGLKLLGHL
SIKFEDHYVITSYIPDFLTLLNKGSVKTKFYVLKVFSCLSKNHANTRELISAKVLSSLVA
PFNKNESKANILNIIEIFENINFQFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLA
EHSDPEVRDKVIRLILKL

Sequence length

558

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARMCX5-related disorder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes Genes most often co-reported with ARMCX5 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ARMCX5.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ARMCX5 (see Related Genes above), that are NOT already directly curated for ARMCX5 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ARMCX5.

ARMCX5 (armadillo repeat containing X-linked 5)

Bookmark This Gene