ARMCX1 (armadillo repeat containing X-linked 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51309
Gene name Armadillo repeat containing X-linked 1
Gene symbol ARMCX1
Synonyms (NCBI Gene)
ALEX1GASP7
Chromosome X
Chromosome location Xq22.1
Summary This gene encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are invo
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT799312 hsa-miR-4528 CLIP-seq
MIRT799313 hsa-miR-4720-3p CLIP-seq
MIRT799314 hsa-miR-4804-3p CLIP-seq
MIRT1936010 hsa-miR-3662 CLIP-seq
MIRT799313 hsa-miR-4720-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005741 Component Mitochondrial outer membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300362 18073 ENSG00000126947
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P291
Protein name Armadillo repeat-containing X-linked protein 1 (ARM protein lost in epithelial cancers on chromosome X 1) (Protein ALEX1)
Protein function Regulates mitochondrial transport during axon regeneration. Increases the proportion of motile mitochondria by recruiting stationary mitochondria into the motile pool. Enhances mitochondria movement and neurite growth in both adult axons and emb
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04826 Arm_2 194 → 447 Armadillo-like Family
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels ovary, heart, testis, prostate, brain, spleen and colon. Expressed at very low levels in liver and thymus. Not expressed in peripheral blood leukocytes. Not or reduced expressed in lung, prostate, colon, pancre
Sequence 
MGRTREAGCVAAGVVIGAGACYCVYRLAWGRDENEKIWDEDEESTDTSEIGVETVKGAKT
NAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQAS
AKAGKGARVGTISGNRTLAPSLPCPGGRGGGCHPTRSGSRAGGRASGKSKGKARSKSTRA
PATTWPVRRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQ
NAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDTMVCRL
DSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQIMKLIINFTENPAM
TRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKNEGLASSRKEFSRSSLFFL
FKESGVCVKKIKALANHNDLVVKVKVLKVLTKL
Sequence length 453
Interactions View interactions

No strongly related genes found yet for ARMCX1.

No additional diseases found yet through genes similar to ARMCX1.