Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	158763
Gene name	Rho GTPase activating protein 36
Gene symbol	ARHGAP36
Synonyms (NCBI Gene)	-
Chromosome	X
Chromosome location	Xq26.1

22 Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018956	hsa-miR-335-5p	Microarray	18185580
MIRT794825	hsa-miR-1184	CLIP-seq
MIRT794826	hsa-miR-1205	CLIP-seq
MIRT794827	hsa-miR-1323	CLIP-seq
MIRT794828	hsa-miR-214	CLIP-seq
MIRT794829	hsa-miR-2467-3p	CLIP-seq
MIRT794830	hsa-miR-3158-5p	CLIP-seq
MIRT794831	hsa-miR-3619-5p	CLIP-seq
MIRT794832	hsa-miR-3661	CLIP-seq
MIRT794833	hsa-miR-3670	CLIP-seq
MIRT794834	hsa-miR-3678-3p	CLIP-seq
MIRT794835	hsa-miR-4291	CLIP-seq
MIRT794836	hsa-miR-548a-3p	CLIP-seq
MIRT794837	hsa-miR-548e	CLIP-seq
MIRT794838	hsa-miR-548f	CLIP-seq
MIRT794839	hsa-miR-548g	CLIP-seq
MIRT794840	hsa-miR-548o	CLIP-seq
MIRT794841	hsa-miR-548p	CLIP-seq
MIRT794842	hsa-miR-631	CLIP-seq
MIRT794843	hsa-miR-761	CLIP-seq
MIRT794844	hsa-miR-922	CLIP-seq
MIRT2174430	hsa-miR-4422	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007015	Process	Actin filament organization	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0015629	Component	Actin cytoskeleton	IBA

MIM	HGNC	e!Ensembl
300937	26388	ENSG00000147256

Q6ZRI8

Protein name

Rho GTPase-activating protein 36

Protein function

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00620	RhoGAP	236 → 396	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in the outer root sheath of hair follicles at the level of the stem cell bulge, during the anagen and telogen phases of hair growth (at protein level). {ECO:0000269|PubMed:35986704}.

Sequence

MGGCIPFLKAARALCPRIMPPLLLLSAFIFLVSVLGGAPGHNPDRRTKMVSIHSLSELER
LKLQETAYHELVARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEV
LVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRRVFGRIRRFFSRRRNEPTLPREFT
RRGRRGAVSVDSLAELEDGALLLQTLQLSKISFPIGQRLLGSKRKMSLNPIAKQIPQVVE
ACCQFIEKHGLSAVGIFTLEYSVQRVRQLREEFDQGLDVVLDDNQNVHDVAALLKEFFRD
MKDSLLPDDLYMSFLLTATLKPQDQLSALQLLVYLMPPCHSDTLERLLKALHKITENCED
SIGIDGQLVPGNRMTSTNLALVFGSALLKKGKFGKRESRKTKLGIDHYVASVNVVRAMID
NWDVLFQVPPHIQRQVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSA
EARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQDRPLLRVPREKEAKT
GVSYFFP

Sequence length

547

Interactions

View interactions

Reactome Pathway
Rho GTPase cycle

Related Genes Genes most often co-reported with ARHGAP36 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ARHGAP36.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ARHGAP36 (see Related Genes above), that are NOT already directly curated for ARHGAP36 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ARHGAP36.

ARHGAP36 (Rho GTPase activating protein 36)

Bookmark This Gene