Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	89839
Gene name	Rho GTPase activating protein 11B
Gene symbol	ARHGAP11B
Synonyms (NCBI Gene)	B'-TFAM7B1GAP (1-8)
Chromosome	15
Chromosome location	15q13.2

7 Show/Hide all (7)

miRTarBase ID	miRNA	Experiments
MIRT793617	hsa-miR-3591-5p	CLIP-seq
MIRT793618	hsa-miR-4473	CLIP-seq
MIRT793619	hsa-miR-4671-3p	CLIP-seq
MIRT793620	hsa-miR-495	CLIP-seq
MIRT793621	hsa-miR-512-3p	CLIP-seq
MIRT793622	hsa-miR-513a-3p	CLIP-seq
MIRT793623	hsa-miR-520f	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IDA	25721503, 27957544
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	31883789
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	31883789
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006543	Process	L-glutamine catabolic process	IDA	31883789
GO:0007165	Process	Signal transduction	IEA
GO:0021987	Process	Cerebral cortex development	IDA	25721503, 27957544, 31883789, 33938018
GO:0035795	Process	Negative regulation of mitochondrial membrane permeability	IDA	31883789
GO:0043547	Process	Positive regulation of GTPase activity	IDA	27957544
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
616310	15782	ENSG00000285077

Q3KRB8

Protein name

Inactive Rho GTPase-activating protein 11B (Rho-type GTPase-activating protein 11B)

Protein function

Hominin-specific protein that promotes development and evolutionary expansion of the brain neocortex (PubMed:25721503, PubMed:27957544, PubMed:30484771, PubMed:32554627, PubMed:33938018). Able to promote amplification of basal progenitors in the

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00620	RhoGAP	66 → 213	RhoGAP domain	Domain

Sequence

MWDQRLVKLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVP
EYGHIPSFLVDACTSLEEHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGL
LKQFFRELPEPILPADLHEALLKAQQLGTEEKNKAILLLSCLLADHTVHVLRYFFNFLRN
VSLRSSENKMDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMVS
VLLHHWKALKKVNMKLLVNIREREDNV

Sequence length

267

Interactions

View interactions

Reactome Pathway
Rho GTPase cycle

Related Genes Genes most often co-reported with ARHGAP11B across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ARHGAP11B.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ARHGAP11B (see Related Genes above), that are NOT already directly curated for ARHGAP11B itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ARHGAP11B.

ARHGAP11B (Rho GTPase activating protein 11B)

Bookmark This Gene