Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55082
Gene name	Arginine and glutamate rich 1
Gene symbol	ARGLU1
Synonyms (NCBI Gene)	-
Chromosome	13
Chromosome location	13q33.3

108 Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021029	hsa-miR-155-5p	Proteomics	18668040
MIRT024091	hsa-miR-1-3p	Proteomics	18668040
MIRT028287	hsa-miR-32-5p	Sequencing	20371350
MIRT037100	hsa-miR-877-3p	CLASH	23622248
MIRT559553	hsa-miR-548u	PAR-CLIP	20371350
MIRT559552	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT559551	hsa-miR-1243	PAR-CLIP	20371350
MIRT559550	hsa-miR-4463	PAR-CLIP	20371350
MIRT559547	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT559546	hsa-miR-107	PAR-CLIP	20371350
MIRT559544	hsa-miR-4684-3p	PAR-CLIP	20371350
MIRT559542	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT559541	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT559540	hsa-miR-5047	PAR-CLIP	20371350
MIRT559538	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT559553	hsa-miR-548u	PAR-CLIP	21572407
MIRT559552	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT559551	hsa-miR-1243	PAR-CLIP	21572407
MIRT559550	hsa-miR-4463	PAR-CLIP	21572407
MIRT559549	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT559548	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT559547	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT559546	hsa-miR-107	PAR-CLIP	21572407
MIRT559545	hsa-miR-1193	PAR-CLIP	21572407
MIRT559544	hsa-miR-4684-3p	PAR-CLIP	21572407
MIRT559543	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT559542	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT559541	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT559540	hsa-miR-5047	PAR-CLIP	21572407
MIRT559539	hsa-miR-432-3p	PAR-CLIP	21572407
MIRT559538	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT734952	hsa-miR-3613-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	33165823
MIRT559553	hsa-miR-548u	PAR-CLIP	20371350
MIRT559552	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT559551	hsa-miR-1243	PAR-CLIP	20371350
MIRT559550	hsa-miR-4463	PAR-CLIP	20371350
MIRT559547	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT559546	hsa-miR-107	PAR-CLIP	20371350
MIRT559544	hsa-miR-4684-3p	PAR-CLIP	20371350
MIRT559542	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT559541	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT559540	hsa-miR-5047	PAR-CLIP	20371350
MIRT559538	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT559553	hsa-miR-548u	PAR-CLIP	21572407
MIRT559552	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT559551	hsa-miR-1243	PAR-CLIP	21572407
MIRT559550	hsa-miR-4463	PAR-CLIP	21572407
MIRT559549	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT559548	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT559547	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT559546	hsa-miR-107	PAR-CLIP	21572407
MIRT559545	hsa-miR-1193	PAR-CLIP	21572407
MIRT559544	hsa-miR-4684-3p	PAR-CLIP	21572407
MIRT559543	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT559542	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT559541	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT559540	hsa-miR-5047	PAR-CLIP	21572407
MIRT559539	hsa-miR-432-3p	PAR-CLIP	21572407
MIRT559538	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT793533	hsa-miR-1197	CLIP-seq
MIRT793534	hsa-miR-144	CLIP-seq
MIRT793535	hsa-miR-299-5p	CLIP-seq
MIRT793536	hsa-miR-335	CLIP-seq
MIRT793537	hsa-miR-4457	CLIP-seq
MIRT793538	hsa-miR-4709-5p	CLIP-seq
MIRT793539	hsa-miR-4712-5p	CLIP-seq
MIRT793540	hsa-miR-513b	CLIP-seq
MIRT793541	hsa-miR-770-5p	CLIP-seq
MIRT1934150	hsa-miR-219-1-3p	CLIP-seq
MIRT1934151	hsa-miR-361-5p	CLIP-seq
MIRT1934152	hsa-miR-759	CLIP-seq
MIRT2174009	hsa-miR-138	CLIP-seq
MIRT2174010	hsa-miR-2110	CLIP-seq
MIRT2174011	hsa-miR-4271	CLIP-seq
MIRT793538	hsa-miR-4709-5p	CLIP-seq
MIRT2174012	hsa-miR-4714-5p	CLIP-seq
MIRT2174013	hsa-miR-4725-3p	CLIP-seq
MIRT2174014	hsa-miR-4797-5p	CLIP-seq
MIRT2174015	hsa-miR-483-3p	CLIP-seq
MIRT2174016	hsa-miR-548aa	CLIP-seq
MIRT2174017	hsa-miR-618	CLIP-seq
MIRT2174018	hsa-miR-668	CLIP-seq
MIRT793534	hsa-miR-144	CLIP-seq
MIRT2477596	hsa-miR-200b	CLIP-seq
MIRT2477597	hsa-miR-200c	CLIP-seq
MIRT1934150	hsa-miR-219-1-3p	CLIP-seq
MIRT2477598	hsa-miR-3149	CLIP-seq
MIRT793536	hsa-miR-335	CLIP-seq
MIRT2477599	hsa-miR-3545-3p	CLIP-seq
MIRT1934151	hsa-miR-361-5p	CLIP-seq
MIRT2477600	hsa-miR-429	CLIP-seq
MIRT2477601	hsa-miR-452	CLIP-seq
MIRT2477602	hsa-miR-4539	CLIP-seq
MIRT2477603	hsa-miR-4676-3p	CLIP-seq
MIRT793538	hsa-miR-4709-5p	CLIP-seq
MIRT2477604	hsa-miR-4724-5p	CLIP-seq
MIRT1934152	hsa-miR-759	CLIP-seq
MIRT2477605	hsa-miR-873	CLIP-seq
MIRT2477596	hsa-miR-200b	CLIP-seq
MIRT2477597	hsa-miR-200c	CLIP-seq
MIRT1934150	hsa-miR-219-1-3p	CLIP-seq
MIRT2477598	hsa-miR-3149	CLIP-seq
MIRT2477599	hsa-miR-3545-3p	CLIP-seq
MIRT1934151	hsa-miR-361-5p	CLIP-seq
MIRT2477600	hsa-miR-429	CLIP-seq
MIRT2477602	hsa-miR-4539	CLIP-seq
MIRT2477604	hsa-miR-4724-5p	CLIP-seq
MIRT1934152	hsa-miR-759	CLIP-seq

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IMP	30698747
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	30698747
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	22365833, 23602568, 30698747, 33961781, 39251607
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IDA	30698747
GO:0016607	Component	Nuclear speck	IEA
GO:0036002	Function	Pre-mRNA binding	IDA	30698747
GO:0036002	Function	Pre-mRNA binding	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA

MIM	HGNC	e!Ensembl
614046	25482	ENSG00000134884

Q9NWB6

Protein name

Arginine and glutamate-rich protein 1

Protein function

Dual function regulator of gene expression; regulator of transcription and modulator of alternative splicing (PubMed:30698747). General coactivator of nuclear receptor-induced gene expression, including genes activated by the glucocorticoid rece

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15346	ARGLU	119 → 269	Arginine and glutamate-rich 1	Coiled-coil

Sequence

MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRS
TNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQE
IEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQR
QAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKL
EQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD

Sequence length

273

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARGLU1-related disorder	Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36418457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21454576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21454576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40473764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	30698747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21454576		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ARGLU1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ARGLU1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ARGLU1 (see Related Genes above), that are NOT already directly curated for ARGLU1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ARGLU1.

ARGLU1 (arginine and glutamate rich 1)

Bookmark This Gene