APOL5 (apolipoprotein L5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 80831
Gene name Apolipoprotein L5
Gene symbol APOL5
Synonyms (NCBI Gene)
APOL-VAPOLV
Chromosome 22
Chromosome location 22q12.3
Summary This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT790214 hsa-miR-3064-3p CLIP-seq
MIRT790215 hsa-miR-4252 CLIP-seq
MIRT790216 hsa-miR-4317 CLIP-seq
MIRT790217 hsa-miR-4715-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005737 Component Cytoplasm IEA
GO:0006629 Process Lipid metabolic process NAS 11374903
GO:0006869 Process Lipid transport IEA
GO:0008035 Function High-density lipoprotein particle binding NAS 11374903
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607255 14869 ENSG00000128313
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BWW9
Protein name Apolipoprotein L5 (Apolipoprotein L-V) (ApoL-V)
Protein function May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05461 ApoL 44 → 350 Apolipoprotein L Family
Tissue specificity TISSUE SPECIFICITY: Low level of expression; detected in uterus, testis, skeletal muscle and stomach.
Sequence 
MPCGKQGNLQVPGSKVLPGLGEGCKEMWLRKVIYGGEVWGKSPEPEFPSLVNLCQSWKIN
NLMSTVHSDEAGMLSYFLFEELMRCDKDSMPDGNLSEEEKLFLSYFPLHKFELEQNIKEL
NTLADQVDTTHELLTKTSLVASSSGAVSGVMNILGLALAPVTAGGSLMLSATGTGLGAAA
AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGI
KDLHAYQMAKSNSGFMAMVKNFVAKRHIPFWTARGVQRAFEGTTLAMTNGAWVMGAAGAG
FLLMKDMSSFLQSWKHLEDGARTETAEELRALAKKLEQELDRLTQHHRHLPQKASQTCSS
SRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGPGVALRTPKRTVSAPRMLGHQPAPPAP
ARKGRQAPGRHRQ
Sequence length 433
Interactions View interactions

No strongly related genes found yet for APOL5.

No additional diseases found yet through genes similar to APOL5.