APOL1 (apolipoprotein L1)

Gene

• Entrez ID: 8542
• Gene name: Apolipoprotein L1
• Gene symbol: APOL1
• Synonyms (NCBI Gene): APO-L, APOL, APOL-I, FSGS4
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma an

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs60910145	T>G	Risk-factor, not-provided, pathogenic	Coding sequence variant, missense variant
rs71785313	TTATAA>-	Risk-factor, pathogenic	Inframe deletion, coding sequence variant
rs73885319	A>G	Risk-factor, not-provided, pathogenic	Coding sequence variant, missense variant
rs1428826948	T>G	Risk-factor	Synonymous variant, coding sequence variant
rs1569534160	A>G	Risk-factor	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT690968	hsa-miR-122-3p	HITS-CLIP	23313552
MIRT690967	hsa-miR-1306-5p	HITS-CLIP	23313552
MIRT690966	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT690965	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT690964	hsa-miR-1915-3p	HITS-CLIP	23313552
MIRT690963	hsa-miR-6764-5p	HITS-CLIP	23313552
MIRT690962	hsa-miR-4726-3p	HITS-CLIP	23313552
MIRT690961	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT690960	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT690959	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT690958	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT690957	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT690956	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT690955	hsa-miR-1976	HITS-CLIP	23313552
MIRT690954	hsa-miR-2276-3p	HITS-CLIP	23313552
MIRT690953	hsa-miR-4284	HITS-CLIP	23313552
MIRT690952	hsa-miR-4279	HITS-CLIP	23313552
MIRT738016	hsa-miR-4518	HITS-CLIP	33718276
MIRT738019	hsa-miR-4507	HITS-CLIP	33718276
MIRT690968	hsa-miR-122-3p	HITS-CLIP	23313552
MIRT690967	hsa-miR-1306-5p	HITS-CLIP	23313552
MIRT690966	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT690965	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT690964	hsa-miR-1915-3p	HITS-CLIP	23313552
MIRT690963	hsa-miR-6764-5p	HITS-CLIP	23313552
MIRT690962	hsa-miR-4726-3p	HITS-CLIP	23313552
MIRT690961	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT690960	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT690959	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT690958	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT690957	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT690956	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT690955	hsa-miR-1976	HITS-CLIP	23313552
MIRT690954	hsa-miR-2276-3p	HITS-CLIP	23313552
MIRT690953	hsa-miR-4284	HITS-CLIP	23313552
MIRT690952	hsa-miR-4279	HITS-CLIP	23313552
MIRT690958	hsa-miR-6741-3p	qRT-PCR	34089082
MIRT790070	hsa-miR-106a	CLIP-seq
MIRT790071	hsa-miR-106b	CLIP-seq
MIRT790072	hsa-miR-1193	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790074	hsa-miR-122	CLIP-seq
MIRT790075	hsa-miR-1273f	CLIP-seq
MIRT790076	hsa-miR-1289	CLIP-seq
MIRT790077	hsa-miR-143	CLIP-seq
MIRT790078	hsa-miR-150	CLIP-seq
MIRT790079	hsa-miR-17	CLIP-seq
MIRT790080	hsa-miR-20a	CLIP-seq
MIRT790081	hsa-miR-20b	CLIP-seq
MIRT790082	hsa-miR-2392	CLIP-seq
MIRT790083	hsa-miR-302a	CLIP-seq
MIRT790084	hsa-miR-302b	CLIP-seq
MIRT790085	hsa-miR-302c	CLIP-seq
MIRT790086	hsa-miR-302d	CLIP-seq
MIRT790087	hsa-miR-302e	CLIP-seq
MIRT790088	hsa-miR-3135b	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT790090	hsa-miR-3198	CLIP-seq
MIRT790091	hsa-miR-3652	CLIP-seq
MIRT790092	hsa-miR-372	CLIP-seq
MIRT790093	hsa-miR-373	CLIP-seq
MIRT790094	hsa-miR-423-3p	CLIP-seq
MIRT790095	hsa-miR-4294	CLIP-seq
MIRT790096	hsa-miR-4309	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790098	hsa-miR-4430	CLIP-seq
MIRT790099	hsa-miR-4438	CLIP-seq
MIRT790100	hsa-miR-4454	CLIP-seq
MIRT790101	hsa-miR-4534	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790105	hsa-miR-4708-5p	CLIP-seq
MIRT790106	hsa-miR-4770	CLIP-seq
MIRT790107	hsa-miR-5095	CLIP-seq
MIRT790108	hsa-miR-519d	CLIP-seq
MIRT790109	hsa-miR-520a-3p	CLIP-seq
MIRT790110	hsa-miR-520b	CLIP-seq
MIRT790111	hsa-miR-520c-3p	CLIP-seq
MIRT790112	hsa-miR-520d-3p	CLIP-seq
MIRT790113	hsa-miR-520e	CLIP-seq
MIRT790114	hsa-miR-520g	CLIP-seq
MIRT790115	hsa-miR-520h	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT790117	hsa-miR-720	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT790119	hsa-miR-93	CLIP-seq
MIRT790072	hsa-miR-1193	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790074	hsa-miR-122	CLIP-seq
MIRT790076	hsa-miR-1289	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT790121	hsa-miR-1307	CLIP-seq
MIRT790082	hsa-miR-2392	CLIP-seq
MIRT790122	hsa-miR-3122	CLIP-seq
MIRT790088	hsa-miR-3135b	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT790090	hsa-miR-3198	CLIP-seq
MIRT790091	hsa-miR-3652	CLIP-seq
MIRT790124	hsa-miR-3689a-3p	CLIP-seq
MIRT790125	hsa-miR-3689c	CLIP-seq
MIRT790126	hsa-miR-3913-5p	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT790128	hsa-miR-4258	CLIP-seq
MIRT790095	hsa-miR-4294	CLIP-seq
MIRT790096	hsa-miR-4309	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790098	hsa-miR-4430	CLIP-seq
MIRT790099	hsa-miR-4438	CLIP-seq
MIRT790100	hsa-miR-4454	CLIP-seq
MIRT790101	hsa-miR-4534	CLIP-seq
MIRT790129	hsa-miR-4638-5p	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790130	hsa-miR-4728-5p	CLIP-seq
MIRT790131	hsa-miR-4735-5p	CLIP-seq
MIRT790132	hsa-miR-4761-5p	CLIP-seq
MIRT790133	hsa-miR-4775	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT790107	hsa-miR-5095	CLIP-seq
MIRT790135	hsa-miR-541	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT790136	hsa-miR-590-3p	CLIP-seq
MIRT790137	hsa-miR-654-5p	CLIP-seq
MIRT790117	hsa-miR-720	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT790072	hsa-miR-1193	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790074	hsa-miR-122	CLIP-seq
MIRT790075	hsa-miR-1273f	CLIP-seq
MIRT790076	hsa-miR-1289	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT790121	hsa-miR-1307	CLIP-seq
MIRT790077	hsa-miR-143	CLIP-seq
MIRT790082	hsa-miR-2392	CLIP-seq
MIRT790088	hsa-miR-3135b	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT790090	hsa-miR-3198	CLIP-seq
MIRT790091	hsa-miR-3652	CLIP-seq
MIRT790128	hsa-miR-4258	CLIP-seq
MIRT790095	hsa-miR-4294	CLIP-seq
MIRT790096	hsa-miR-4309	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790098	hsa-miR-4430	CLIP-seq
MIRT790099	hsa-miR-4438	CLIP-seq
MIRT790100	hsa-miR-4454	CLIP-seq
MIRT790101	hsa-miR-4534	CLIP-seq
MIRT790129	hsa-miR-4638-5p	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790105	hsa-miR-4708-5p	CLIP-seq
MIRT790131	hsa-miR-4735-5p	CLIP-seq
MIRT790106	hsa-miR-4770	CLIP-seq
MIRT790133	hsa-miR-4775	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT790107	hsa-miR-5095	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT790136	hsa-miR-590-3p	CLIP-seq
MIRT790117	hsa-miR-720	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT790072	hsa-miR-1193	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT790082	hsa-miR-2392	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790100	hsa-miR-4454	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790133	hsa-miR-4775	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT790136	hsa-miR-590-3p	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT790072	hsa-miR-1193	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT790082	hsa-miR-2392	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790100	hsa-miR-4454	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT790072	hsa-miR-1193	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT790082	hsa-miR-2392	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790100	hsa-miR-4454	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790131	hsa-miR-4735-5p	CLIP-seq
MIRT790133	hsa-miR-4775	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT790136	hsa-miR-590-3p	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT790072	hsa-miR-1193	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790082	hsa-miR-2392	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790100	hsa-miR-4454	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT790074	hsa-miR-122	CLIP-seq
MIRT790075	hsa-miR-1273f	CLIP-seq
MIRT790076	hsa-miR-1289	CLIP-seq
MIRT790121	hsa-miR-1307	CLIP-seq
MIRT790077	hsa-miR-143	CLIP-seq
MIRT1933061	hsa-miR-1915	CLIP-seq
MIRT1933062	hsa-miR-2276	CLIP-seq
MIRT1933063	hsa-miR-3120-5p	CLIP-seq
MIRT790122	hsa-miR-3122	CLIP-seq
MIRT790088	hsa-miR-3135b	CLIP-seq
MIRT790090	hsa-miR-3198	CLIP-seq
MIRT1933064	hsa-miR-335	CLIP-seq
MIRT790091	hsa-miR-3652	CLIP-seq
MIRT1933065	hsa-miR-3664-5p	CLIP-seq
MIRT790124	hsa-miR-3689a-3p	CLIP-seq
MIRT790125	hsa-miR-3689c	CLIP-seq
MIRT790126	hsa-miR-3913-5p	CLIP-seq
MIRT790095	hsa-miR-4294	CLIP-seq
MIRT790096	hsa-miR-4309	CLIP-seq
MIRT1933066	hsa-miR-4330	CLIP-seq
MIRT790098	hsa-miR-4430	CLIP-seq
MIRT1933067	hsa-miR-4522	CLIP-seq
MIRT790101	hsa-miR-4534	CLIP-seq
MIRT790129	hsa-miR-4638-5p	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT790105	hsa-miR-4708-5p	CLIP-seq
MIRT790130	hsa-miR-4728-5p	CLIP-seq
MIRT790132	hsa-miR-4761-5p	CLIP-seq
MIRT790106	hsa-miR-4770	CLIP-seq
MIRT790135	hsa-miR-541	CLIP-seq
MIRT790137	hsa-miR-654-5p	CLIP-seq
MIRT790117	hsa-miR-720	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT790121	hsa-miR-1307	CLIP-seq
MIRT1933061	hsa-miR-1915	CLIP-seq
MIRT1933062	hsa-miR-2276	CLIP-seq
MIRT790122	hsa-miR-3122	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT1933064	hsa-miR-335	CLIP-seq
MIRT790124	hsa-miR-3689a-3p	CLIP-seq
MIRT790125	hsa-miR-3689c	CLIP-seq
MIRT2173238	hsa-miR-3714	CLIP-seq
MIRT790126	hsa-miR-3913-5p	CLIP-seq
MIRT2173239	hsa-miR-3926	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT2173240	hsa-miR-4433	CLIP-seq
MIRT2173241	hsa-miR-4459	CLIP-seq
MIRT790129	hsa-miR-4638-5p	CLIP-seq
MIRT2173242	hsa-miR-4683	CLIP-seq
MIRT2173243	hsa-miR-4722-5p	CLIP-seq
MIRT790130	hsa-miR-4728-5p	CLIP-seq
MIRT790131	hsa-miR-4735-5p	CLIP-seq
MIRT790132	hsa-miR-4761-5p	CLIP-seq
MIRT2173244	hsa-miR-4768-3p	CLIP-seq
MIRT790133	hsa-miR-4775	CLIP-seq
MIRT2173245	hsa-miR-4786-5p	CLIP-seq
MIRT2173246	hsa-miR-4793-5p	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT790135	hsa-miR-541	CLIP-seq
MIRT2173247	hsa-miR-548s	CLIP-seq
MIRT790136	hsa-miR-590-3p	CLIP-seq
MIRT790137	hsa-miR-654-5p	CLIP-seq
MIRT790117	hsa-miR-720	CLIP-seq
MIRT2173248	hsa-miR-890	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT2173249	hsa-miR-940	CLIP-seq
MIRT2384326	hsa-miR-24	CLIP-seq
MIRT790122	hsa-miR-3122	CLIP-seq
MIRT1933064	hsa-miR-335	CLIP-seq
MIRT790124	hsa-miR-3689a-3p	CLIP-seq
MIRT790125	hsa-miR-3689c	CLIP-seq
MIRT790126	hsa-miR-3913-5p	CLIP-seq
MIRT738020	hsa-miR-3940-5p	CLIP-seq
MIRT2173240	hsa-miR-4433	CLIP-seq
MIRT2173241	hsa-miR-4459	CLIP-seq
MIRT790130	hsa-miR-4728-5p	CLIP-seq
MIRT790132	hsa-miR-4761-5p	CLIP-seq
MIRT2173244	hsa-miR-4768-3p	CLIP-seq
MIRT790135	hsa-miR-541	CLIP-seq
MIRT790137	hsa-miR-654-5p	CLIP-seq
MIRT2476410	hsa-miR-1207-5p	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT790074	hsa-miR-122	CLIP-seq
MIRT2476411	hsa-miR-1226	CLIP-seq
MIRT2476412	hsa-miR-1273	CLIP-seq
MIRT2476413	hsa-miR-1273c	CLIP-seq
MIRT2476414	hsa-miR-1285	CLIP-seq
MIRT2476415	hsa-miR-1287	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT2476416	hsa-miR-1298	CLIP-seq
MIRT790121	hsa-miR-1307	CLIP-seq
MIRT2476417	hsa-miR-1343	CLIP-seq
MIRT2476418	hsa-miR-141	CLIP-seq
MIRT2476419	hsa-miR-142-3p	CLIP-seq
MIRT790078	hsa-miR-150	CLIP-seq
MIRT2476420	hsa-miR-1827	CLIP-seq
MIRT2476421	hsa-miR-1909	CLIP-seq
MIRT1933061	hsa-miR-1915	CLIP-seq
MIRT2476422	hsa-miR-193a-5p	CLIP-seq
MIRT2476423	hsa-miR-200a	CLIP-seq
MIRT2476424	hsa-miR-25	CLIP-seq
MIRT1933063	hsa-miR-3120-5p	CLIP-seq
MIRT790122	hsa-miR-3122	CLIP-seq
MIRT790088	hsa-miR-3135b	CLIP-seq
MIRT2476425	hsa-miR-3137	CLIP-seq
MIRT2476426	hsa-miR-3144-5p	CLIP-seq
MIRT2476427	hsa-miR-3145-5p	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT2476428	hsa-miR-3153	CLIP-seq
MIRT2476429	hsa-miR-3160-5p	CLIP-seq
MIRT2476430	hsa-miR-3187-5p	CLIP-seq
MIRT2476431	hsa-miR-32	CLIP-seq
MIRT2476432	hsa-miR-3200-5p	CLIP-seq
MIRT2476433	hsa-miR-329	CLIP-seq
MIRT1933064	hsa-miR-335	CLIP-seq
MIRT2476434	hsa-miR-345	CLIP-seq
MIRT2476435	hsa-miR-3612	CLIP-seq
MIRT2476436	hsa-miR-361-3p	CLIP-seq
MIRT2476437	hsa-miR-3619-3p	CLIP-seq
MIRT2476438	hsa-miR-362-3p	CLIP-seq
MIRT2476439	hsa-miR-363	CLIP-seq
MIRT790091	hsa-miR-3652	CLIP-seq
MIRT1933065	hsa-miR-3664-5p	CLIP-seq
MIRT2476440	hsa-miR-367	CLIP-seq
MIRT2476441	hsa-miR-3675-3p	CLIP-seq
MIRT2476442	hsa-miR-3681	CLIP-seq
MIRT790124	hsa-miR-3689a-3p	CLIP-seq
MIRT790125	hsa-miR-3689c	CLIP-seq
MIRT2476443	hsa-miR-3691-5p	CLIP-seq
MIRT2173238	hsa-miR-3714	CLIP-seq
MIRT790126	hsa-miR-3913-5p	CLIP-seq
MIRT2173239	hsa-miR-3926	CLIP-seq
MIRT2476444	hsa-miR-3941	CLIP-seq
MIRT2476445	hsa-miR-3945	CLIP-seq
MIRT2476446	hsa-miR-3978	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT2476447	hsa-miR-4253	CLIP-seq
MIRT2476448	hsa-miR-4256	CLIP-seq
MIRT790128	hsa-miR-4258	CLIP-seq
MIRT2476449	hsa-miR-4277	CLIP-seq
MIRT2476450	hsa-miR-4283	CLIP-seq
MIRT2476451	hsa-miR-4303	CLIP-seq
MIRT2476452	hsa-miR-4313	CLIP-seq
MIRT2476453	hsa-miR-4325	CLIP-seq
MIRT1933066	hsa-miR-4330	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT790098	hsa-miR-4430	CLIP-seq
MIRT2476454	hsa-miR-4432	CLIP-seq
MIRT2173240	hsa-miR-4433	CLIP-seq
MIRT2476455	hsa-miR-4436b-3p	CLIP-seq
MIRT790099	hsa-miR-4438	CLIP-seq
MIRT2173241	hsa-miR-4459	CLIP-seq
MIRT2476456	hsa-miR-4467	CLIP-seq
MIRT2476457	hsa-miR-4486	CLIP-seq
MIRT2476458	hsa-miR-4489	CLIP-seq
MIRT2476459	hsa-miR-4492	CLIP-seq
MIRT2476460	hsa-miR-4498	CLIP-seq
MIRT2476461	hsa-miR-4505	CLIP-seq
MIRT2476462	hsa-miR-451b	CLIP-seq
MIRT2476463	hsa-miR-452	CLIP-seq
MIRT1933067	hsa-miR-4522	CLIP-seq
MIRT790129	hsa-miR-4638-5p	CLIP-seq
MIRT2476464	hsa-miR-4655-5p	CLIP-seq
MIRT2476465	hsa-miR-4659a-3p	CLIP-seq
MIRT2476466	hsa-miR-4659b-3p	CLIP-seq
MIRT2476467	hsa-miR-466	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT2476468	hsa-miR-4672	CLIP-seq
MIRT2476469	hsa-miR-4676-3p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT2173242	hsa-miR-4683	CLIP-seq
MIRT2476470	hsa-miR-4691-5p	CLIP-seq
MIRT2476471	hsa-miR-4693-3p	CLIP-seq
MIRT2476472	hsa-miR-4696	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT2173243	hsa-miR-4722-5p	CLIP-seq
MIRT790130	hsa-miR-4728-5p	CLIP-seq
MIRT2476473	hsa-miR-4733-3p	CLIP-seq
MIRT790131	hsa-miR-4735-5p	CLIP-seq
MIRT790132	hsa-miR-4761-5p	CLIP-seq
MIRT2476474	hsa-miR-4762-3p	CLIP-seq
MIRT2476475	hsa-miR-4763-3p	CLIP-seq
MIRT2173244	hsa-miR-4768-3p	CLIP-seq
MIRT790133	hsa-miR-4775	CLIP-seq
MIRT2476476	hsa-miR-4777-3p	CLIP-seq
MIRT2173245	hsa-miR-4786-5p	CLIP-seq
MIRT2173246	hsa-miR-4793-5p	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT2476477	hsa-miR-490-3p	CLIP-seq
MIRT790107	hsa-miR-5095	CLIP-seq
MIRT2476478	hsa-miR-516a-3p	CLIP-seq
MIRT2476479	hsa-miR-518d-5p	CLIP-seq
MIRT2476480	hsa-miR-519b-5p	CLIP-seq
MIRT2476481	hsa-miR-519c-5p	CLIP-seq
MIRT2476482	hsa-miR-520c-5p	CLIP-seq
MIRT2476483	hsa-miR-526a	CLIP-seq
MIRT790135	hsa-miR-541	CLIP-seq
MIRT2476484	hsa-miR-548c-3p	CLIP-seq
MIRT2476485	hsa-miR-548g	CLIP-seq
MIRT2173247	hsa-miR-548s	CLIP-seq
MIRT2476486	hsa-miR-548u	CLIP-seq
MIRT2476487	hsa-miR-555	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT2476488	hsa-miR-587	CLIP-seq
MIRT790136	hsa-miR-590-3p	CLIP-seq
MIRT2476489	hsa-miR-602	CLIP-seq
MIRT2476490	hsa-miR-603	CLIP-seq
MIRT2476491	hsa-miR-612	CLIP-seq
MIRT2476492	hsa-miR-650	CLIP-seq
MIRT790137	hsa-miR-654-5p	CLIP-seq
MIRT2476493	hsa-miR-665	CLIP-seq
MIRT2476494	hsa-miR-762	CLIP-seq
MIRT2476495	hsa-miR-875-3p	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT2476496	hsa-miR-92a	CLIP-seq
MIRT2476497	hsa-miR-92b	CLIP-seq
MIRT2173249	hsa-miR-940	CLIP-seq
MIRT2476498	hsa-miR-942	CLIP-seq
MIRT2476499	hsa-miR-943	CLIP-seq
MIRT2476410	hsa-miR-1207-5p	CLIP-seq
MIRT790073	hsa-miR-1208	CLIP-seq
MIRT2476411	hsa-miR-1226	CLIP-seq
MIRT2476412	hsa-miR-1273	CLIP-seq
MIRT2476413	hsa-miR-1273c	CLIP-seq
MIRT2476414	hsa-miR-1285	CLIP-seq
MIRT2476415	hsa-miR-1287	CLIP-seq
MIRT790120	hsa-miR-129-5p	CLIP-seq
MIRT2476416	hsa-miR-1298	CLIP-seq
MIRT2476417	hsa-miR-1343	CLIP-seq
MIRT2476418	hsa-miR-141	CLIP-seq
MIRT790078	hsa-miR-150	CLIP-seq
MIRT2476420	hsa-miR-1827	CLIP-seq
MIRT2476421	hsa-miR-1909	CLIP-seq
MIRT1933061	hsa-miR-1915	CLIP-seq
MIRT2476423	hsa-miR-200a	CLIP-seq
MIRT2476424	hsa-miR-25	CLIP-seq
MIRT1933063	hsa-miR-3120-5p	CLIP-seq
MIRT790122	hsa-miR-3122	CLIP-seq
MIRT790088	hsa-miR-3135b	CLIP-seq
MIRT2476426	hsa-miR-3144-5p	CLIP-seq
MIRT2476427	hsa-miR-3145-5p	CLIP-seq
MIRT790123	hsa-miR-3149	CLIP-seq
MIRT790089	hsa-miR-3152-3p	CLIP-seq
MIRT2476428	hsa-miR-3153	CLIP-seq
MIRT2476429	hsa-miR-3160-5p	CLIP-seq
MIRT2476430	hsa-miR-3187-5p	CLIP-seq
MIRT2476431	hsa-miR-32	CLIP-seq
MIRT2476432	hsa-miR-3200-5p	CLIP-seq
MIRT2476433	hsa-miR-329	CLIP-seq
MIRT1933064	hsa-miR-335	CLIP-seq
MIRT2476434	hsa-miR-345	CLIP-seq
MIRT2476435	hsa-miR-3612	CLIP-seq
MIRT2476436	hsa-miR-361-3p	CLIP-seq
MIRT2476437	hsa-miR-3619-3p	CLIP-seq
MIRT2675169	hsa-miR-3620	CLIP-seq
MIRT2476438	hsa-miR-362-3p	CLIP-seq
MIRT2476439	hsa-miR-363	CLIP-seq
MIRT1933065	hsa-miR-3664-5p	CLIP-seq
MIRT2476440	hsa-miR-367	CLIP-seq
MIRT2476441	hsa-miR-3675-3p	CLIP-seq
MIRT2476442	hsa-miR-3681	CLIP-seq
MIRT790124	hsa-miR-3689a-3p	CLIP-seq
MIRT790125	hsa-miR-3689c	CLIP-seq
MIRT2476443	hsa-miR-3691-5p	CLIP-seq
MIRT2173238	hsa-miR-3714	CLIP-seq
MIRT790126	hsa-miR-3913-5p	CLIP-seq
MIRT2173239	hsa-miR-3926	CLIP-seq
MIRT2476444	hsa-miR-3941	CLIP-seq
MIRT2476445	hsa-miR-3945	CLIP-seq
MIRT2476446	hsa-miR-3978	CLIP-seq
MIRT790127	hsa-miR-411	CLIP-seq
MIRT2476447	hsa-miR-4253	CLIP-seq
MIRT2476448	hsa-miR-4256	CLIP-seq
MIRT790128	hsa-miR-4258	CLIP-seq
MIRT2476449	hsa-miR-4277	CLIP-seq
MIRT2476450	hsa-miR-4283	CLIP-seq
MIRT2476451	hsa-miR-4303	CLIP-seq
MIRT2476452	hsa-miR-4313	CLIP-seq
MIRT2476453	hsa-miR-4325	CLIP-seq
MIRT1933066	hsa-miR-4330	CLIP-seq
MIRT790097	hsa-miR-4420	CLIP-seq
MIRT2476454	hsa-miR-4432	CLIP-seq
MIRT2173240	hsa-miR-4433	CLIP-seq
MIRT2476455	hsa-miR-4436b-3p	CLIP-seq
MIRT790099	hsa-miR-4438	CLIP-seq
MIRT2173241	hsa-miR-4459	CLIP-seq
MIRT2476456	hsa-miR-4467	CLIP-seq
MIRT2476457	hsa-miR-4486	CLIP-seq
MIRT2476458	hsa-miR-4489	CLIP-seq
MIRT2476459	hsa-miR-4492	CLIP-seq
MIRT2476460	hsa-miR-4498	CLIP-seq
MIRT2476461	hsa-miR-4505	CLIP-seq
MIRT2476462	hsa-miR-451b	CLIP-seq
MIRT2476463	hsa-miR-452	CLIP-seq
MIRT1933067	hsa-miR-4522	CLIP-seq
MIRT2476467	hsa-miR-466	CLIP-seq
MIRT790102	hsa-miR-4662a-5p	CLIP-seq
MIRT2476468	hsa-miR-4672	CLIP-seq
MIRT2476469	hsa-miR-4676-3p	CLIP-seq
MIRT790103	hsa-miR-4676-5p	CLIP-seq
MIRT2173242	hsa-miR-4683	CLIP-seq
MIRT2476470	hsa-miR-4691-5p	CLIP-seq
MIRT2476471	hsa-miR-4693-3p	CLIP-seq
MIRT2476472	hsa-miR-4696	CLIP-seq
MIRT790104	hsa-miR-4707-3p	CLIP-seq
MIRT2173243	hsa-miR-4722-5p	CLIP-seq
MIRT790130	hsa-miR-4728-5p	CLIP-seq
MIRT2476473	hsa-miR-4733-3p	CLIP-seq
MIRT790131	hsa-miR-4735-5p	CLIP-seq
MIRT790132	hsa-miR-4761-5p	CLIP-seq
MIRT2476474	hsa-miR-4762-3p	CLIP-seq
MIRT2476475	hsa-miR-4763-3p	CLIP-seq
MIRT2173244	hsa-miR-4768-3p	CLIP-seq
MIRT790133	hsa-miR-4775	CLIP-seq
MIRT2476476	hsa-miR-4777-3p	CLIP-seq
MIRT2173245	hsa-miR-4786-5p	CLIP-seq
MIRT2173246	hsa-miR-4793-5p	CLIP-seq
MIRT790134	hsa-miR-483-5p	CLIP-seq
MIRT2476477	hsa-miR-490-3p	CLIP-seq
MIRT790107	hsa-miR-5095	CLIP-seq
MIRT2476478	hsa-miR-516a-3p	CLIP-seq
MIRT2476479	hsa-miR-518d-5p	CLIP-seq
MIRT2476480	hsa-miR-519b-5p	CLIP-seq
MIRT2476481	hsa-miR-519c-5p	CLIP-seq
MIRT2476482	hsa-miR-520c-5p	CLIP-seq
MIRT2476483	hsa-miR-526a	CLIP-seq
MIRT790135	hsa-miR-541	CLIP-seq
MIRT2476484	hsa-miR-548c-3p	CLIP-seq
MIRT2476485	hsa-miR-548g	CLIP-seq
MIRT2173247	hsa-miR-548s	CLIP-seq
MIRT2476486	hsa-miR-548u	CLIP-seq
MIRT790116	hsa-miR-575	CLIP-seq
MIRT2476488	hsa-miR-587	CLIP-seq
MIRT790136	hsa-miR-590-3p	CLIP-seq
MIRT2476489	hsa-miR-602	CLIP-seq
MIRT2476490	hsa-miR-603	CLIP-seq
MIRT2476491	hsa-miR-612	CLIP-seq
MIRT2476492	hsa-miR-650	CLIP-seq
MIRT790137	hsa-miR-654-5p	CLIP-seq
MIRT2476493	hsa-miR-665	CLIP-seq
MIRT2476494	hsa-miR-762	CLIP-seq
MIRT2476495	hsa-miR-875-3p	CLIP-seq
MIRT790118	hsa-miR-892a	CLIP-seq
MIRT2476496	hsa-miR-92a	CLIP-seq
MIRT2476497	hsa-miR-92b	CLIP-seq
MIRT2173249	hsa-miR-940	CLIP-seq
MIRT2476499	hsa-miR-943	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IDA	16020735
GO:0005515	Function	Protein binding	IPI	12621437, 22582013, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	17192540
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008289	Function	Lipid binding	IBA
GO:0008289	Function	Lipid binding	IDA	16020735
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IC	16020735
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	17154273
GO:0034364	Component	High-density lipoprotein particle	IDA	9325276
GO:0034364	Component	High-density lipoprotein particle	IEA
GO:0042157	Process	Lipoprotein metabolic process	IEA
GO:0045087	Process	Innate immune response	IDA	17192540
GO:0051838	Process	Cytolysis by host of symbiont cells	IDA	12621437, 17192540
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1902476	Process	Chloride transmembrane transport	IDA	16020735

Other IDs

• MIM: 603743
• HGNC: 618
• e!Ensembl: ENSG00000100342

Protein

• UniProt ID: O14791
• Protein name: Apolipoprotein L1 (Apolipoprotein L) (Apo-L) (ApoL) (Apolipoprotein L-I) (ApoL-I)
• Protein function: May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver.
• PDB: 7L6K, 7LF7, 7LFA, 7LFB, 7LFD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05461	ApoL	78 → 392	Apolipoprotein L	Family

• Tissue specificity: TISSUE SPECIFICITY: Plasma. Found on APOA-I-containing high density lipoprotein (HDL3). Expressed in pancreas, lung, prostate, liver, placenta and spleen.
• Sequence:

  MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTM
  DPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLAR
  QMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSG
  SLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQAQA
  HDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHAS
  ASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLH
  EGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL

• Sequence length: 398

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APOL1-associated kidney disease	Conflicting classifications of pathogenicity; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APOL1-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCIUM METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corticosteroids response	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal segmental glomerulosclerosis	Conflicting classifications of pathogenicity; risk factor	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Focal segmental glomerulosclerosis 4, susceptibility to	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity; risk factor	ClinVar ClinGen, ClinVar, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Glomerulonephritis	Conflicting classifications of pathogenicity; risk factor	ClinVar Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY STEROID-RESISTANT NEPHROTIC SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyalinosis, Segmental Glomerular	Conflicting classifications of pathogenicity; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPARATHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic range proteinuria	Conflicting classifications of pathogenicity; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Conflicting classifications of pathogenicity; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sickled erythrocytes	Conflicting classifications of pathogenicity; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steroid-resistant nephrotic syndrome	Conflicting classifications of pathogenicity; risk factor	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32792518	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29357419, 31116585		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	21910715, 26206798, 28466968, 28699644, 30557319, 35405207	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21910715, 26147622, 26206798, 28466968, 28699644, 31158233		★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	28850570	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	28850570	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	30287079	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23766536, 25054777, 25887069, 26634651, 26966015, 27157696, 29042080, 29113983		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23766536, 24379297, 25054777, 25887069, 26634651, 26966015, 27157696, 29042080, 29113983		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24379297, 26634651, 27157696, 28850570, 29269352	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	25573908, 26150607	Associate	★☆☆☆☆ Found in Text Mining only
Azotemia	Azotemia	BEFREE	28218918		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	30451737		★☆☆☆☆ Found in Text Mining only
Bernard Soulier Syndrome	Bernard-soulier syndrome	Pubtator	20635188	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	26375446	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	32561682	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35250881	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32671843	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24379297, 25029429, 25549121, 26152403, 26634651, 26966015, 27023839, 27418089, 28143671, 28611783, 28850570, 29110759, 29406442, 29971324, 31082862, 31532792		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24379297, 26112018, 26634651, 27112635, 27418089, 28572159, 28850570, 29269352, 29899045, 29971324, 31337231, 31532792, 35660539, 36310009, 37778341	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	28850570	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28975602, 29899045	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	27342958		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	28975602, 29899045	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28975602, 29971324		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28143671		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	26634651	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	20635188, 21358326, 21698141, 21849968, 21878839, 21910715, 21968013, 21968148, 22068337, 22357707, 22695330, 22965004, 24157943, 24206458, 24504811, 24586071, 25530085, 25549121, 26215860, 26343748, 26773863, 27157696, 27588375, 27997071, 28218918, 28339911, 28699644, 28842513, 29110762, 29110763, 29685497, 29885931, 30982552, 30995638, 31092297, 31217349, 31606237, 31664093, 31732553, 31833966		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21429915, 22569246, 22878977, 22956460, 23516419, 23768513, 23860441, 24206458, 24233469, 24379297, 24591025, 25029429, 25081748, 25549121, 25561578, 26112018, 26773863, 27023839, 27035887, 27190333, 27870653, 27927600, 28187045, 28611783, 28650456, 28992354, 29110759, 29110760, 29420808, 29967295, 30054024, 30332315, 30340464, 30369398, 30371607, 30451737, 30507707, 30557319, 30976395, 30982552, 31023447, 31082862, 31182139, 31217349, 31241995, 31337231, 31449181, 31563468, 31590185, 31661509, 31732553		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29348836		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22569246		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29971324		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15604524, 29971324		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28850570, 29269352, 31337231	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	29899045	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29971324		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17966030		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21997396, 22068337, 24206458, 26966015, 27157696, 27342958, 28771472		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	37585454	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21454968, 22956460, 24206458, 24385048, 26112018, 28339911, 29899045	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21997396, 22068337, 24206458, 26966015, 27157696, 27342958, 28771472		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37924378	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24385048, 25796344, 26091559, 29862302, 33430853	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37924378	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10946010, 21849968, 25054777, 25249559, 29113983, 31092297, 31619724		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	21931123, 22956460, 24157943, 27711207, 29862302, 31182139, 33430853, 34440683	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21429915, 21931123, 24011553, 24157943, 27711207, 30998685, 31182139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	GWASCAT_DG	26305897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	11930015		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	11930015	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	22068337, 31023447		★☆☆☆☆ Found in Text Mining only
Familial hematuria	Hematuria	BEFREE	23516419		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	20647424, 20668430, 21358326, 21910715, 21997392, 21997394, 21997396, 21997397, 22614628, 22791322, 23300552, 23470819, 23860441, 24130771, 24500309, 24861084, 25168831, 25530085, 25561578, 25993319, 26553514, 26901816, 27638911, 28242845, 28391347, 28494221, 28842513, 29992269, 30054024, 30082052, 30343724, 30624253, 31116068, 31198534, 31601430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	GWASCAT_DG	20668430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	21997394, 21997397		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32792518, 35820647	Associate	★☆☆☆☆ Found in Text Mining only
Genetic steroid-resistant nephrotic syndrome	Genetic Steroid-Resistant Nephrotic Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	GWASDB_DG	20668430		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Glomerulonephritis	Glomerulonephritis	Pubtator	24899058, 25573908, 26091559, 30995638	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Glomerulonephritis	Glomerulonephritis	BEFREE	30995638		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	36763808, 37511514	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	GWASDB_DG	20668430		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	23300552, 24119848, 24899058, 25081748, 25573908, 26553514, 28218918, 30343724, 31023447		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	20647424, 20668430, 21910715, 21997392, 21997394, 21997396, 22791322, 22956460, 23766536, 25100047, 25530085, 27190333, 27588375, 27638911, 29531077, 30054024, 30287079, 31601430, 33019829, 33646395, 34727096, 34929253, 36227935, 36763813, 37258049, 38036523	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27112635, 33794228	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29269352, 29971324, 33461980	Associate	★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	23516419	Associate	★☆☆☆☆ Found in Text Mining only
Hyalinosis, Segmental Glomerular	Glomerular Hyalinosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	Pubtator	10946010	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	27112635		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	15604524		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	10946010	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	10946010, 19239905		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	27112635	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	27112635		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	20635188, 20647424, 21997396, 22832513, 22956460, 23271482, 24206458, 25530085, 26112018, 26747051, 27230965, 27932478, 28335839, 28938952, 29051146, 29971324, 31532792, 32851884, 33782552, 35100591, 35244702, 35358541, 35660539	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Renal	Renal hypertension	Pubtator	37105192	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20647424, 21997396, 22068337, 22257798, 22614628, 22832513, 22878977, 23271482, 23470819, 23860441, 25054777, 25081748, 25530085, 26112018, 26206798, 26430087, 26901816, 26940095, 26966015, 27230965, 28335839, 28545715, 28771472, 28842513, 28938952, 29406442, 29971324, 30369398, 31023447, 31532792		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	21997392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive Nephropathy	Hypertensive nephropathy	Pubtator	21997392	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	32575434	Associate	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	10946010	Associate	★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	10946010	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24899058, 37098381	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	21691125		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	21997397		★☆☆☆☆ Found in Text Mining only
Immune Complex Diseases	Immune Complex Diseases	BEFREE	29110758		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29110758		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31619724	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	31085678	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28975602		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20647424, 20688934, 21216884, 21454968, 21486385, 21537348, 21910715, 21931123, 21968013, 21968148, 21997392, 21997394, 21997396, 21997397, 21997398, 22068337, 22119407, 22135313, 22189356, 22257798, 22357707, 22495294, 22614628, 22695330, 22832513, 22878977, 23271482, 23300552, 23397215, 23438974, 23470819, 23677244, 23715117, 23860441, 24119848, 24157943, 24231663, 24233469, 24280748, 24504811, 24518129, 24591025, 24808134, 24827777, 24899058, 24903390, 25054777, 25081748, 25090991, 25100047, 25168831, 25168832, 25249559, 25281610, 25530085, 25561578, 25573908, 25788523, 25809272, 25853332, 25921719, 25933006, 25993319, 26025194, 26049628, 26089538, 26091559, 26147622, 26152403, 26180129, 26206798, 26215860, 26343748, 26430087, 26553514, 26586272, 26634651, 26668025, 26699492, 26940095, 26945671, 26947522, 27005919, 27023839, 27157696, 27230965, 27418089, 27509583, 27588375, 27599995, 27638911, 27864430, 27870653, 28143671, 28218918, 28265848, 28335839, 28339911, 28385815, 28391347, 28481398, 28537557, 28572159, 28699644, 28724794, 28918394, 28938952, 29042080, 29110756, 29110757, 29110758, 29110759, 29110760, 29110761, 29110762, 29357411, 29389775, 29406442, 29420808, 29470556, 29792270, 29885931, 29886044, 29930940, 29971324, 30054024, 30082052, 30173819, 30226866, 30320619, 30332315, 30343724, 30369398, 30371607, 30431460, 30451737, 30466562, 30507707, 30733285, 30982552, 30995638, 31023447, 31050035, 31082862, 31158233, 31182139, 31217349, 31449181, 31480040, 31532792, 31563468, 31590185, 31601430, 31606237, 31611067, 31661509		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20647424, 20668430, 21454968, 21486385, 21910715, 21931123, 21997392, 21997394, 21997396, 21997398, 22119407, 22135313, 22487534, 22495294, 22832513, 22956460, 23271482, 23300552, 23677244, 23715117, 23766536, 24157943, 24280748, 24385048, 24504811, 24518129, 24551085, 24899058, 25012173, 25081748, 25100047, 25249559, 25281610, 25530085, 25573908, 25788523, 25809272, 25884165, 25921719, 25924622, 25933006, 25993319, 26025194, 26038529, 26091559, 26112018, 26150607, 26152403, 26180129, 26206798, 26343748, 26586272, 26634651, 26668025, 26699492, 26940095, 27035887, 27157696, 27190333, 27418089, 27588375, 27599995, 27638911, 27650483, 27821631, 27932478, 28087008, 28335839, 28385815, 28466968, 28537557, 28572159, 28699644, 28732083, 28938952, 29042080, 29051146, 29180397, 29269352, 29420808, 29531077, 29792270, 29880816, 29971324, 30054024, 30173819, 30466562, 30733285, 30733721, 30995638, 31182139, 31337231, 31412021, 31532792, 31558683, 31590185, 31601430, 31611067, 31704668, 31732553, 32018194, 32187552, 32434471, 32434723, 32561682, 32656538, 32659871, 32675303, 32851884, 32866949, 32894582, 32972761, 33214201, 33380423, 33461980, 33794228, 34089082, 34154709, 34779415, 34870514, 35089317, 35100591, 35232775, 35244702, 35358541, 35368828, 35372896, 35372954, 35577564, 36011371, 36227935, 36580463, 36758113, 36763808, 36763813, 37098381, 37106136, 38036523, 38154557, 39225089	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	21698141, 21881214, 21968013, 22695330, 22878977, 26747051, 30360961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	20635188, 20647424, 21698141, 21849968, 21878839, 21910715, 21997394, 21997396, 22135313, 22487534, 22695330, 23028791, 23766536, 24157943, 24206458, 24385048, 24551085, 25349204, 25530085, 25573908, 25887069, 26343748, 26430087, 26773863, 26940095, 26966015, 27588375, 27932478, 27997071, 28339911, 28699644, 29051146, 29339549, 29685497, 30995638, 31664093, 32894582, 33461980, 35100591, 36034035, 37105192, 37258049, 37778341	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27576016		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	20635188, 21358326, 21698141, 21849968, 21878839, 21910715, 21968013, 21968148, 22068337, 22357707, 22695330, 22965004, 24157943, 24206458, 24504811, 24586071, 25530085, 25549121, 26215860, 26343748, 26773863, 27157696, 27588375, 27997071, 28218918, 28339911, 28699644, 28842513, 29110762, 29110763, 29685497, 29885931, 30982552, 30995638, 31092297, 31217349, 31606237, 31664093, 31732553, 31833966		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	31178898		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	22832513, 25281610, 25921719, 26966015, 36763813, 39225089	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29042080		★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	34331942	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	22952321, 30642866		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23520206, 28850570, 30642866, 31601430, 33461980, 37105192	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	22952321, 30642866		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22952321, 23520206, 24504811, 28265848, 28850570, 30642866, 31601430		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	22189356, 24504811, 24658608, 28265848, 31664093, 31732553		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	22189356, 24658608, 31664093, 31732553, 37105192	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	22952321, 30642866		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	30642866	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	30642866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22569246, 27157405		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	31601430	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	34087900	Associate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30624253		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37924378	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31619724		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27821631, 31558683, 32866949, 35372896	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25029429, 26634651		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26634651, 28850570	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	24899058, 29967295	Associate	★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	34727096	Associate	★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	25081748		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	25081748		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	22135313, 23300552	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	32680910	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	24130771, 26150607, 26215859, 27190333, 30955946		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	27190333, 29277510, 30348286, 31754646, 32972761	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	37511514	Stimulate	★☆☆☆☆ Found in Text Mining only
NEPHROTIC SYNDROME, STEROID-RESISTANT, AUTOSOMAL RECESSIVE	Nephritis	ORPHANET_DG	20668430, 26901816		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	26091559		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22239288, 26430087, 28992354		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22239288, 26038529, 26430087, 34766590	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29123261		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34341330, 37588985	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27157405		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	31337231	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	28850570	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	21910715, 23715117, 24518129, 26206798, 28572159, 28699644, 29051146, 34154709, 36227935	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22569246		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	21997394, 22878977, 23300552, 24861084, 27190333, 27638911, 28218918, 29110758, 29110762, 29406442, 30343718, 30624253		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	21910715		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11930015, 15949655, 17502270, 18632255, 20483474		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	11930015	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	18632255	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31704668, 37882666	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27559702, 31704668		★☆☆☆☆ Found in Text Mining only
Shprintzen syndrome	Shprintzen Syndrome	BEFREE	11930015		★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	11930015		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	29277510, 29992269		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	29277510		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	29971324, 31337231	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34315402, 35090432	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	28850570	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	30173819	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	CLINVAR_DG	20647424		★☆☆☆☆ Found in Text Mining only