APOBR (apolipoprotein B receptor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55911
• Gene name: Apolipoprotein B receptor
• Gene symbol: APOBR
• Synonyms (NCBI Gene): APOB100R, APOB48R
• Chromosome: 16
• Chromosome location: 16p12.1
• Summary: Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells.

miRNA Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT790024	hsa-miR-1224-3p	CLIP-seq
MIRT790025	hsa-miR-1260	CLIP-seq
MIRT790026	hsa-miR-1260b	CLIP-seq
MIRT790027	hsa-miR-1280	CLIP-seq
MIRT790028	hsa-miR-3150a-3p	CLIP-seq
MIRT790029	hsa-miR-3175	CLIP-seq
MIRT790030	hsa-miR-3914	CLIP-seq
MIRT790031	hsa-miR-3928	CLIP-seq
MIRT790032	hsa-miR-4269	CLIP-seq
MIRT790033	hsa-miR-4436b-3p	CLIP-seq
MIRT790034	hsa-miR-4505	CLIP-seq
MIRT790035	hsa-miR-4667-5p	CLIP-seq
MIRT790036	hsa-miR-4685-5p	CLIP-seq
MIRT790037	hsa-miR-4700-5p	CLIP-seq
MIRT790038	hsa-miR-4731-5p	CLIP-seq
MIRT790039	hsa-miR-4757-5p	CLIP-seq
MIRT790040	hsa-miR-513c	CLIP-seq
MIRT790041	hsa-miR-514b-5p	CLIP-seq
MIRT790042	hsa-miR-532-3p	CLIP-seq
MIRT790043	hsa-miR-939	CLIP-seq
MIRT2173202	hsa-miR-125a-5p	CLIP-seq
MIRT2173203	hsa-miR-125b	CLIP-seq
MIRT2173204	hsa-miR-128	CLIP-seq
MIRT2173205	hsa-miR-2467-3p	CLIP-seq
MIRT2173206	hsa-miR-323-5p	CLIP-seq
MIRT2173207	hsa-miR-3620	CLIP-seq
MIRT2173208	hsa-miR-4264	CLIP-seq
MIRT2173209	hsa-miR-4319	CLIP-seq
MIRT2173210	hsa-miR-4324	CLIP-seq
MIRT2173211	hsa-miR-4797-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PPARA	Repression	12700342
PPARG	Repression	12700342

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005813	Component	Centrosome	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	IBA
GO:0006869	Process	Lipid transport	IEA
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030228	Function	Lipoprotein particle receptor activity	IEA
GO:0030229	Function	Very-low-density lipoprotein particle receptor activity	IBA
GO:0034361	Component	Very-low-density lipoprotein particle	IEA
GO:0034362	Component	Low-density lipoprotein particle	IEA
GO:0042627	Component	Chylomicron	IEA

Other IDs

• MIM: 605220
• HGNC: 24087
• e!Ensembl: ENSG00000184730

Protein

• UniProt ID: Q0VD83
• Protein name: Apolipoprotein B receptor (Apolipoprotein B-100 receptor) (Apolipoprotein B-48 receptor) (Apolipoprotein B48 receptor) (apoB-48R)
• Protein function: Macrophage receptor that binds to the apolipoprotein B48 (APOB) of dietary triglyceride (TG)-rich lipoproteins (TRL) or to a like domain of APOB in hypertriglyceridemic very low density lipoprotein (HTG-VLDL). Binds and internalizes TRL when out
• Tissue specificity: TISSUE SPECIFICITY: Expressed in peripheral blood leukocytes > bone marrow = spleen > lymph node, and only faintly visible in appendix and thymus. Expressed in the brain, heart, kidney, liver, lung, pancreas, and placenta. Expressed primarily by reticuloe
• Sequence:

  MDFLRLYLPGLHQALRGALDSLGTFVSYLLGDAVPTVEREAQAAEELGVVAVGKTGKIVE
  EEAQEDLEGLRGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGA
  GETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNREERLRSWEQEE
  EEEEVRAREPGMARGAESEWTWHGETEGKAGAVGPKAAGDNREMEQGVREADAGETEEPG
  AEGAGKGEEVVVVEKACESTRAWGTWGPGAEPEDWGILGREEARTTPGREEARAILDGEE
  ARTISGGEEAETASGGEEAETASGGEEAGTASGGEEAGIASGGEAGTASGGEEAGTASGG
  EEAGTASGGDEAWTTSGKEEADLLGVRQTEYGAVPGERLLEATGKVWVLEEEGDEEREAE
  VSPFPKQPQVLGTERTEEAAESQTAGREAVGGQEAGESFEGQVDLRGKEAEMRQDLGIRA
  DRARMEELVQAEEAQEERGSSRDPVAELPSDGEAEGTADLEATPEARPEEELTGEESEAA
  QTSCGLLGVEWGGLTHSVTKGQGPELMGGAQTPTKQPEEREAGEVELMGVLALSKEEQER
  SLEAGPRHAGSVKPEASEAFPGAWENRTRKDMERGNTQEDAADGEQREEEETAGGQTLAA
  EAEGDRESELSEVPEAGGEGLTTQDAGCGTEEGEASVSENQELDGSTGADAGPCPSLGEA
  YARETEDEEAEADRTSRRGWRLQAVAVGLPDREDAQTGSVAAGIMGGDVVPHISAAGAGE
  ALEGVLGQGWDSKEKEEAAAGEHAGGQEFGLEGSAEEEVTGRGSQVEAFESREGGPWGGR
  VEAEESAGAEDSCGLDPAGSQTARAEGMGAMVEAGGLLEKWTLLEEEAVGWQEREQREDS
  EGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAP
  ESVGEAETAEAMGSARGGAANSWSEAPLPGSLLDVSVPRSRVHLSRSSSQRRSRPSFRRT
  PAWEQQEEPPAPNPPEEELSAPEQRPLQLEEPLEPSPLRHDGTPVPARRRPLGHGFGLAH
  PGMMQELQARLGRPKPQ

• Sequence length: 1097

Pathways

Reactome Pathway:

VLDL clearance

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	29679657	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	39749473	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39749473	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	15591219		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24560518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24560518	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	12700342, 22190030	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15591219		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15591219		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	LHGDN	15830122		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	15830122		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30272292		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	30272292	Associate	★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	31179571		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23519644, 24560518, 25955518		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24560518, 25955518, 26449484	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	39457448	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for APOBR.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to APOBR.