APMAP (adipocyte plasma membrane associated protein)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57136
Gene name Adipocyte plasma membrane associated protein
Gene symbol APMAP
Synonyms (NCBI Gene)
BSCvC20orf3
Chromosome 20
Chromosome location 20p11.21
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT023339 hsa-miR-122-5p Proteomics 21750653
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004064 Function Arylesterase activity IBA
GO:0004064 Function Arylesterase activity IDA 18513186
GO:0005515 Function Protein binding IPI 32296183
GO:0009986 Component Cell surface IDA 18513186
GO:0016020 Component Membrane HDA 19946888
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615884 13238 ENSG00000101474
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HDC9
Protein name Adipocyte plasma membrane-associated protein (Protein BSCv)
Protein function Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role in adipocyte differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03088 Str_synth 201 → 289 Strictosidine synthase Family
Tissue specificity TISSUE SPECIFICITY: Liver, glomerular and tubular structures of the kidney, endothelial cells, arterial wall and pancreatic islets of Langerhans (at protein level). Found ubiquitously in adult as well as in embryonic tissues. In adult tissue, the highest
Sequence 
MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMML
LESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGR
VVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKR
EVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLL
EYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVEN
MPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPR
YSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV
Sequence length 416
Interactions View interactions

No strongly related genes found yet for APMAP.

No additional diseases found yet through genes similar to APMAP.