APLP1 (amyloid beta precursor like protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 333
• Gene name: Amyloid beta precursor like protein 1
• Gene symbol: APLP1
• Synonyms (NCBI Gene): APLP
• Chromosome: 19
• Chromosome location: 19q13.12
• Summary: This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleav

miRNA Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016721	hsa-miR-335-5p	Microarray	18185580
MIRT041986	hsa-miR-484	CLASH	23622248
MIRT041986	hsa-miR-484	CLASH	23622248
MIRT1932932	hsa-miR-3192	CLIP-seq
MIRT2173080	hsa-miR-1285	CLIP-seq
MIRT2173081	hsa-miR-3187-5p	CLIP-seq
MIRT2173082	hsa-miR-378g	CLIP-seq
MIRT2173083	hsa-miR-4437	CLIP-seq
MIRT2173084	hsa-miR-4486	CLIP-seq
MIRT2173085	hsa-miR-4674	CLIP-seq
MIRT2173086	hsa-miR-612	CLIP-seq
MIRT2173087	hsa-miR-665	CLIP-seq

Gene ontology (GO) Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16169070, 16193067, 21293490, 32814053
GO:0005604	Component	Basement membrane	TAS	9521588
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16531006
GO:0005886	Component	Plasma membrane	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	9521588
GO:0007409	Process	Axonogenesis	IBA
GO:0007417	Process	Central nervous system development	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0009887	Process	Animal organ morphogenesis	TAS	9521588
GO:0016020	Component	Membrane	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030198	Process	Extracellular matrix organization	ISS
GO:0030900	Process	Forebrain development	IEA
GO:0030900	Process	Forebrain development	ISS
GO:0031694	Function	Alpha-2A adrenergic receptor binding	IBA
GO:0031694	Function	Alpha-2A adrenergic receptor binding	IPI	16531006
GO:0031695	Function	Alpha-2B adrenergic receptor binding	IBA
GO:0031695	Function	Alpha-2B adrenergic receptor binding	IPI	16531006
GO:0031696	Function	Alpha-2C adrenergic receptor binding	IBA
GO:0031696	Function	Alpha-2C adrenergic receptor binding	IPI	16531006
GO:0042802	Function	Identical protein binding	IPI	16193067, 21930949
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16531006
GO:0048513	Process	Animal organ development	IEA
GO:0071874	Process	Cellular response to norepinephrine stimulus	IDA	16531006
GO:0106072	Process	Negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	16531006
GO:0180011	Process	Cytosolic mRNA polyadenylation	IEA

Other IDs

• MIM: 104775
• HGNC: 597
• e!Ensembl: ENSG00000105290

Protein

• UniProt ID: P51693
• Protein name: Amyloid beta precursor like protein 1 (Amyloid beta (A4) precursor-like protein 1) (Amyloid-like protein 1) (APLP) (APLP-1) [Cleaved into: C30]
• Protein function: May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding (By similarity). Couples to JIP signal transduction through C-terminal binding. M
• PDB: 3PMR , 3Q7G , 3Q7L , 3QMK , 4RD9 , 4RDA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02177	APP_N	53 → 154	Amyloid A4 N-terminal heparin-binding	Domain
  PF10515	APP_amyloid	596 → 647	Beta-amyloid precursor protein C-terminus	Family
  PF12924	APP_Cu_bd	155 → 211	Copper-binding of amyloid precursor, CuBD	Domain
  PF12925	APP_E2	285 → 467	E2 domain of amyloid precursor protein	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). {ECO:0000269|PubMed:7494461}.
• Sequence:

  MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLC
  GRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWC
  GGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEA
  CSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPPGTPDPSGTAVGDPSTRSWPPGSRVEGA
  EDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGM
  PGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALNEHFQSILQT
  LEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAE
  QKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQ
  IQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKM
  NPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSM
  LLLRRKKPYGAISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLEERP

• Sequence length: 650

Related Genes

No strongly related genes found yet for APLP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to APLP1.