APCDD1L (APC down-regulated 1 like)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 164284
• Gene name: APC down-regulated 1 like
• Gene symbol: APCDD1L
• Synonyms (NCBI Gene): -
• Chromosome: 20
• Chromosome location: 20q13.32

miRNA Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018396	hsa-miR-335-5p	Microarray	18185580
MIRT789056	hsa-miR-1183	CLIP-seq
MIRT789057	hsa-miR-1245b-5p	CLIP-seq
MIRT789058	hsa-miR-1266	CLIP-seq
MIRT789059	hsa-miR-1321	CLIP-seq
MIRT789060	hsa-miR-1910	CLIP-seq
MIRT789061	hsa-miR-3140-5p	CLIP-seq
MIRT789062	hsa-miR-3142	CLIP-seq
MIRT789063	hsa-miR-328	CLIP-seq
MIRT789064	hsa-miR-361-3p	CLIP-seq
MIRT789065	hsa-miR-3664-3p	CLIP-seq
MIRT789066	hsa-miR-4270	CLIP-seq
MIRT789067	hsa-miR-4287	CLIP-seq
MIRT789068	hsa-miR-4293	CLIP-seq
MIRT789069	hsa-miR-4299	CLIP-seq
MIRT789070	hsa-miR-4441	CLIP-seq
MIRT789071	hsa-miR-4469	CLIP-seq
MIRT789072	hsa-miR-4518	CLIP-seq
MIRT789073	hsa-miR-4685-3p	CLIP-seq
MIRT789074	hsa-miR-4739	CLIP-seq
MIRT789075	hsa-miR-4756-5p	CLIP-seq
MIRT789076	hsa-miR-570	CLIP-seq
MIRT789077	hsa-miR-596	CLIP-seq
MIRT789078	hsa-miR-616	CLIP-seq
MIRT1932773	hsa-miR-4742-5p	CLIP-seq
MIRT1932774	hsa-miR-4790-3p	CLIP-seq
MIRT2172971	hsa-miR-2467-3p	CLIP-seq
MIRT2172972	hsa-miR-4468	CLIP-seq
MIRT2172973	hsa-miR-4733-3p	CLIP-seq
MIRT2384321	hsa-miR-3136-5p	CLIP-seq
MIRT789067	hsa-miR-4287	CLIP-seq
MIRT789068	hsa-miR-4293	CLIP-seq
MIRT789069	hsa-miR-4299	CLIP-seq
MIRT2384322	hsa-miR-4439	CLIP-seq
MIRT789071	hsa-miR-4469	CLIP-seq
MIRT789073	hsa-miR-4685-3p	CLIP-seq
MIRT789077	hsa-miR-596	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8NCL9
• Protein name: Protein APCDD1-like (Adenomatosis polyposis coli down-regulated 1 protein-like)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14921	APCDDC	36 → 271	Adenomatosis polyposis coli down-regulated 1	Domain
  PF14921	APCDDC	274 → 461	Adenomatosis polyposis coli down-regulated 1	Domain

• Sequence:

  MPAAMLPYACVLVLLGAHTAPAAGEAGGSCLRWEPHCQQPLPDRVPSTAILPPRLNGPWI
  STGCEVRPGPEFLTRAYTFYPSRLFRAHQFYYEDPFCGEPAHSLLVKGKVRLRRASWVTR
  GATEADYHLHKVGIVFHSRRALVDVTGRLNQTRAGRDCARRLPPARAWLPGALYELRSAR
  AQGDCLEALGLTMHELSLVRVQRRLQPQPRASPRLVEELYLGDIHTDPAERRHYRPTGYQ
  RPLQSALHHVQPCPACGLIARSDVHHPPVLPPPLALPLHLGGWWVSSGCEVRPAVLFLTR
  LFTFHGHSRSWEGYYHHFSDPACRQPTFTVYAAGRYTRGTPSTRVRGGTELVFEVTRAHV
  TPMDQVTTAMLNFSEPSSCGGAGAWSMGTERDVTATNGCLPLGIRLPHVEYELFKMEQDP
  LGQSLLFIGQRPTDGSSPDTPEKRPTSYQAPLVLCHGEAPDFSRPPQHRPSLQKHPSTGG
  LHIAPFPLLPLVLGLAFLHWL

• Sequence length: 501

Pathways

KEGG Pathway:

Wnt signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Malignant tumor of esophagus	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinogenesis	Carcinogenesis	Pubtator	34546854	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35414787	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29568882	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38492610	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35414787	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34546854, 35414787	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for APCDD1L.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to APCDD1L.