APBA3 (amyloid beta precursor protein binding family A member 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9546
• Gene name: Amyloid beta precursor protein binding family A member 3
• Gene symbol: APBA3
• Synonyms (NCBI Gene): MGC:15815, X11L2, mint3
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The protein encoded by this gene is a member of the X11 protein family. It is an adapter protein that interacts with the Alzheimer`s disease amyloid precursor protein. This gene product is believed to be involved in signal transduction processes. This gen

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048517	hsa-miR-100-5p	CLASH	23622248
MIRT040391	hsa-miR-615-3p	CLASH	23622248

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IBA
GO:0001701	Process	In utero embryonic development	IEA
GO:0004857	Function	Enzyme inhibitor activity	IDA	19726677
GO:0005515	Function	Protein binding	IPI	10049767, 21903422, 26948053, 28514442, 29426014, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0015031	Process	Protein transport	IEA
GO:0019899	Function	Enzyme binding	IPI	19726677
GO:0043086	Process	Negative regulation of catalytic activity	IDA	19726677
GO:0043197	Component	Dendritic spine	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19726677
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

Other IDs

• MIM: 604262
• HGNC: 580
• e!Ensembl: ENSG00000011132

Protein

• UniProt ID: O96018
• Protein name: Amyloid-beta A4 precursor protein-binding family A member 3 (Adapter protein X11gamma) (Neuron-specific X11L2 protein) (Neuronal Munc18-1-interacting protein 3) (Mint-3)
• Protein function: May modulate processing of the amyloid-beta precursor protein (APP) and hence formation of APP-beta. May enhance the activity of HIF1A in macrophages by inhibiting the activity of HIF1AN.
• PDB: 2YT7 , 2YT8 , 5UWS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	394 → 478	PDZ domain	Domain
  PF00595	PDZ	486 → 558	PDZ domain	Domain
  PF00640	PID	221 → 359	Phosphotyrosine interaction domain (PTB/PID)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues examined with lower levels in brain and testis.
• Sequence:

  MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQEL
  VQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEE
  CPPSQTGPEEPLEPAPRLLQPPEDPDEDSDSPEWVEGASAEQEGSRSSSSSPEPWLETVP
  LVTPEEPPAGAQSPETLASYPAPQEVPGPCDHEDLLDGVIFGARYLGSTQLVSERNPPTS
  TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTADSQEAMMDHALHTISYTADI
  GCVLVLMARRRLARRPAPQDHGRRLYKMLCHVFYAEDAQLIAQAIGQAFAAAYSQFLRES
  GIDPSQVGVHPSPGACHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVESGWGSLLPT
  AVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHC
  PPVTTAIIHRPHAREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHA
  RIIELLTEAYGEVHIKTMPAATYRLLTGQEQPVYL

• Sequence length: 575

Related Genes

No strongly related genes found yet for APBA3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to APBA3.