AP5S1 (adaptor related protein complex 5 subunit sigma 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55317
• Gene name: Adaptor related protein complex 5 subunit sigma 1
• Gene symbol: AP5S1
• Synonyms (NCBI Gene): C20orf29
• Chromosome: 20
• Chromosome location: 20p13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047741	hsa-miR-10a-5p	CLASH	23622248
MIRT047741	hsa-miR-10a-5p	CLASH	23622248
MIRT046383	hsa-miR-15b-5p	CLASH	23622248

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	20613862
GO:0005515	Function	Protein binding	IPI	20613862
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	22022230
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IBA
GO:0005770	Component	Late endosome	IDA	22022230
GO:0005770	Component	Late endosome	NAS	22022230
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	NAS	22022230
GO:0016197	Process	Endosomal transport	IBA
GO:0016197	Process	Endosomal transport	IEA
GO:0016197	Process	Endosomal transport	IMP	22022230
GO:0030119	Component	AP-type membrane coat adaptor complex	IBA
GO:0030119	Component	AP-type membrane coat adaptor complex	IDA	22022230
GO:0030119	Component	AP-type membrane coat adaptor complex	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0044599	Component	AP-5 adaptor complex	NAS	22022230

Other IDs

• MIM: 614824
• HGNC: 15875
• e!Ensembl: ENSG00000125843

Protein

• UniProt ID: Q9NUS5
• Protein name: AP-5 complex subunit sigma-1 (Adaptor-related protein complex 5 sigma subunit) (Sigma5)
• Protein function: As part of AP-5, a probable fifth adaptor protein complex it may be involved in endosomal transport. According to PubMed:20613862, it is required for efficient homologous recombination DNA double-strand break repair. {ECO:0000269|PubMed:20613862
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15001	AP-5_subunit_s1	1 → 195	AP-5 complex subunit sigma-1	Family

• Sequence:

  MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQ
  VESMCRLQQQASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSL
  GFALVLDAHENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLL
  FLNDQFVQGLEKEFSAAWPR

• Sequence length: 200

Related Genes

No strongly related genes found yet for AP5S1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to AP5S1.