Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	728113
Gene name	Annexin A8 like 1
Gene symbol	ANXA8L1
Synonyms (NCBI Gene)	ANXA8ANXA8L2VAC-betabA145E20.2
Chromosome	10
Chromosome location	10q11.22
Summary	This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of th

29 Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028883	hsa-miR-26b-5p	Microarray	19088304
MIRT032208	hsa-let-7b-5p	Proteomics	18668040
MIRT786655	hsa-miR-1205	CLIP-seq
MIRT786656	hsa-miR-1252	CLIP-seq
MIRT786657	hsa-miR-129-3p	CLIP-seq
MIRT786658	hsa-miR-1321	CLIP-seq
MIRT786659	hsa-miR-1827	CLIP-seq
MIRT786660	hsa-miR-1909	CLIP-seq
MIRT786661	hsa-miR-1976	CLIP-seq
MIRT786662	hsa-miR-205	CLIP-seq
MIRT786663	hsa-miR-2116	CLIP-seq
MIRT786664	hsa-miR-3182	CLIP-seq
MIRT786665	hsa-miR-3649	CLIP-seq
MIRT786666	hsa-miR-4270	CLIP-seq
MIRT786667	hsa-miR-4273	CLIP-seq
MIRT786668	hsa-miR-4441	CLIP-seq
MIRT786669	hsa-miR-4476	CLIP-seq
MIRT786670	hsa-miR-4505	CLIP-seq
MIRT786671	hsa-miR-4533	CLIP-seq
MIRT786672	hsa-miR-4649-3p	CLIP-seq
MIRT786673	hsa-miR-4659a-3p	CLIP-seq
MIRT786674	hsa-miR-4659b-3p	CLIP-seq
MIRT786675	hsa-miR-4663	CLIP-seq
MIRT786676	hsa-miR-4677-5p	CLIP-seq
MIRT786677	hsa-miR-4728-3p	CLIP-seq
MIRT786678	hsa-miR-4739	CLIP-seq
MIRT786679	hsa-miR-4756-5p	CLIP-seq
MIRT786661	hsa-miR-1976	CLIP-seq
MIRT2172456	hsa-miR-4747-5p	CLIP-seq

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0007032	Process	Endosome organization	IBA
GO:0012506	Component	Vesicle membrane	IBA
GO:0016197	Process	Endosomal transport	IBA
GO:0042383	Component	Sarcolemma	IBA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5VT79

Protein name

Annexin A8-like protein 1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00191	Annexin	25 → 90	Annexin	Family
PF00191	Annexin	97 → 162	Annexin	Family
PF00191	Annexin	257 → 322	Annexin	Family
PF00191	Annexin	181 → 247	Annexin	Family

Sequence

MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIA
KSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEIL
ASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALAL
QDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSL
EEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYG
KTLSSMIMEDTSGDYKNALLSLVGSDP

Sequence length

327

Interactions

View interactions

Related Genes Genes most often co-reported with ANXA8L1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ANXA8L1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ANXA8L1 (see Related Genes above), that are NOT already directly curated for ANXA8L1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ANXA8L1.

ANXA8L1 (annexin A8 like 1)

Bookmark This Gene