ANP32D (acidic nuclear phosphoprotein 32 family member D)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 23519
Gene name Acidic nuclear phosphoprotein 32 family member D
Gene symbol ANP32D
Synonyms (NCBI Gene)
PP32R2
Chromosome 12
Chromosome location 12q13.11
Summary Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606878 16676 ENSG00000139223
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95626
Protein name Acidic leucine-rich nuclear phosphoprotein 32 family member D (Phosphoprotein 32-related protein 2) (Tumorigenic protein pp32r2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14580 LRR_9 17 → 131 Repeat
Sequence 
MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANL
PKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDL
FTCEVTNLNNY
Sequence length 131
Interactions View interactions

No strongly related genes found yet for ANP32D.

No additional diseases found yet through genes similar to ANP32D.