ANP32CP (acidic nuclear phosphoprotein 32 family member C, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 23520
Gene name Acidic nuclear phosphoprotein 32 family member C, pseudogene
Gene symbol ANP32CP
Synonyms (NCBI Gene)
ANP32CPP32R1
Chromosome 4
Chromosome location 4q32.3
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT051387 hsa-let-7f-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0006913 Process Nucleocytoplasmic transport IBA
GO:0042393 Function Histone binding IBA
GO:0042981 Process Regulation of apoptotic process IBA
GO:0048471 Component Perinuclear region of cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606877 16675 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43423
Protein name Putative uncharacterized protein ANP32CP (Acidic leucine-rich nuclear phosphoprotein 32 family member C) (Phosphoprotein 32-related protein 1) (Tumorigenic protein pp32r1)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in activated stem cells, such as mobilized CD34+ cells and cord blood CD34+ cells, but not in resting bone marrow CD34+ cells. Expressed in a variety of neoplastic cell lines, mainly in prostatic adenocarcinoma cell lines. No
Sequence 
MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDL
PKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCE
VTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQ
VVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK
Sequence length 234
Interactions View interactions

No strongly related genes found yet for ANP32CP.

No additional diseases found yet through genes similar to ANP32CP.