ANKRD40CL (ANKRD40 C-terminal like)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 55018 |
| Gene name | ANKRD40 C-terminal like |
| Gene symbol | ANKRD40CL |
| Synonyms (NCBI Gene) |
C17orf73LINC00483
|
| Chromosome | 17 |
| Chromosome location | 17q21.33 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q53H64 |
| Protein name | Putative ANKRD40 C-terminal-like protein |
| Family and domains | |
| Sequence |
MAEPEQDIGEKPAVRIQNPKENDFIEIELKRQELSYQNLLNVSCCELGIKPERVEKIRKL |
| Sequence length | 114 |
| Interactions | View interactions |
|
Associated diseases
Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Evidence Score:
★☆☆☆☆ Gene-disease association found in Text Mining only
★★☆☆☆ Found in Text Mining and Unknown/Other Associations
★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources
★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Related Genes
Genes most often co-reported with ANKRD40CL across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ANKRD40CL (see Related Genes above), that are NOT already directly curated for ANKRD40CL itself -- a lead worth checking, not a confirmed association.
0
|
|