Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	284615
Gene name	Ankyrin repeat domain 34A
Gene symbol	ANKRD34A
Synonyms (NCBI Gene)	ANKRD34
Chromosome	1
Chromosome location	1q21.1

23 Show/Hide all (23)

miRTarBase ID	miRNA	Experiments
MIRT783582	hsa-miR-1224-3p	CLIP-seq
MIRT783583	hsa-miR-1260	CLIP-seq
MIRT783584	hsa-miR-1260b	CLIP-seq
MIRT783585	hsa-miR-1273g	CLIP-seq
MIRT783586	hsa-miR-1280	CLIP-seq
MIRT783587	hsa-miR-140-5p	CLIP-seq
MIRT783588	hsa-miR-150	CLIP-seq
MIRT783589	hsa-miR-15a	CLIP-seq
MIRT783590	hsa-miR-15b	CLIP-seq
MIRT783591	hsa-miR-16	CLIP-seq
MIRT783592	hsa-miR-195	CLIP-seq
MIRT783593	hsa-miR-2278	CLIP-seq
MIRT783594	hsa-miR-3170	CLIP-seq
MIRT783595	hsa-miR-424	CLIP-seq
MIRT783596	hsa-miR-4649-3p	CLIP-seq
MIRT783597	hsa-miR-4713-5p	CLIP-seq
MIRT783598	hsa-miR-4733-5p	CLIP-seq
MIRT783599	hsa-miR-4796-3p	CLIP-seq
MIRT783600	hsa-miR-497	CLIP-seq
MIRT783601	hsa-miR-532-3p	CLIP-seq
MIRT783602	hsa-miR-548t	CLIP-seq
MIRT783603	hsa-miR-548u	CLIP-seq
MIRT783604	hsa-miR-922	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0071546	Component	Pi-body	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q69YU3

Protein name

Ankyrin repeat domain-containing protein 34A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12796	Ank_2	9 → 108	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	53 → 141	Ankyrin repeats (3 copies)	Repeat

Sequence

MLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMV
RYLLEQGADPNIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVRDHAGASALVHALD
RGDRETLATLLDACKAKGTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPASPSPGF
CTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDPSPSEPLPKPPRHPPK
PLKRLNSEPWGLVAPPQPVPPTEGRPGIERLTAEFNGLTLTGRPRLSRRHSTEGPEDPPP
WAEKVTSGGPLSRRNTAPEAQESGPPSGLRQKLSRMEPVELDTPGHLCPDSPESSRLSLE
RRRYSASPLTLPPAGSAPSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQT
RPGFLPPLNVSPHPPIPDIRPQPGGRAPSLPAPPYAGAPGSPRTKRKLVRRHSMQTEQIR
LLGGFQSLGGPGEPGR

Sequence length

496

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	29915430	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ANKRD34A across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ANKRD34A.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ANKRD34A (see Related Genes above), that are NOT already directly curated for ANKRD34A itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ANKRD34A.

ANKRD34A (ankyrin repeat domain 34A)

Bookmark This Gene