ANKRD26P1 (ankyrin repeat domain 26 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 124149
Gene name Ankyrin repeat domain 26 pseudogene 1
Gene symbol ANKRD26P1
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16q11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 32955 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NSI1
Protein name Putative ankyrin repeat domain-containing protein 26-like protein
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 53 → 146 Ankyrin repeats (3 copies) Repeat
Sequence 
MRRSSGFGGQKGQGPSCSFTGCWCCRGDDVAESDDSPFAQCGYNIQEKHLGKLHRAASRG
EVSKVECILSSGSADLDERDKKKRTALHLACANGHPEVVALLVDRGCQLDVFDNKNRTAL
LKAVQCQEEECATILLEHGADPDLPDVYGNTTLHYAIYNEDIPMTKKLLLHHANIESANK
DELTPFLLAVHEQKQQMEDFLRKQKENLTAVKLESIHQVMSEYKENETPRNPQNSNPEGT
SNKMACLGEGAAGAKVDEIPGNPVKRLFNKPSIDDSRPMSANEDFDFDTEEKATEPANGK
RQNGMGIIESAPQEHTNNENI
Sequence length 321
Interactions View interactions

No strongly related genes found yet for ANKRD26P1.

No additional diseases found yet through genes similar to ANKRD26P1.