ANKRD20A5P (ankyrin repeat domain 20 family member A5, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 440482
Gene name Ankyrin repeat domain 20 family member A5, pseudogene
Gene symbol ANKRD20A5P
Synonyms (NCBI Gene)
ANKRD20A5
Chromosome 18
Chromosome location 18p11.21
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 33833 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0PJZ0
Protein name Putative ankyrin repeat domain-containing protein 20A5 (Ankyrin repeat domain-containing protein 20A5 pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 37 → 130 Ankyrin repeats (3 copies) Repeat
PF13637 Ank_4 100 → 153 Repeat
PF13637 Ank_4 33 → 87 Repeat
Sequence 
MKLFGFRSRRGQTVLGSIDHLYTGSGYRIRYSELQKIHKAAVKGDAAEMERCLARRSGDL
DALDKQHRTALHLACASGHVKVVTLLVNRKCQIDIYDKENRTPLIQAVHCQEEACAVILL
EHGANPNLKDIYGNTALHYAVYSESTSLAEKLLFHGENIEALDKV
Sequence length 165
Interactions View interactions

No strongly related genes found yet for ANKRD20A5P.

No additional diseases found yet through genes similar to ANKRD20A5P.