ANKRD20A12P (ankyrin repeat domain 20 family member A12, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100874392
Gene name Ankyrin repeat domain 20 family member A12, pseudogene
Gene symbol ANKRD20A12P
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location -
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 43603 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NF67
Protein name Putative ankyrin repeat domain-containing protein 20A12 pseudogene
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14915 CCDC144C 1 → 99 CCDC144C protein coiled-coil region Coiled-coil
Sequence 
MKEMYENAEDKVNNSTGKWSCVEERICHLQHENPCIEQQLDDVHQKEDHKEIVTNIQRGF
IESGKKDLMLEEKNKKLMNECDHLKESLFQYEREKAERVVVVRQLQQEAADSLKKLTMLE
SPLEGISHYHINLDETQVPKKKLFQVESQFDDLMVEKEAVSSKCVNLAKENQVFQQKLLS
MKKVQQECEKLEEDKKMLEEEILNLKTHMENSMVELSKLQEYKSELDERAMQAVEKLEEI
HLQEQAQYKKQLEQLNKDIIQLH
Sequence length 263
Interactions View interactions

No strongly related genes found yet for ANKRD20A12P.

No additional diseases found yet through genes similar to ANKRD20A12P.