ANKRD2 (ankyrin repeat domain 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26287
• Gene name: Ankyrin repeat domain 2
• Gene symbol: ANKRD2
• Synonyms (NCBI Gene): ARPP
• Chromosome: 10
• Chromosome location: 10q24.2
• Summary: This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Altern

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046215	hsa-miR-27b-3p	CLASH	23622248
MIRT1931079	hsa-miR-4492	CLIP-seq
MIRT1931080	hsa-miR-4498	CLIP-seq
MIRT1931081	hsa-miR-4505	CLIP-seq
MIRT1931082	hsa-miR-762	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	24434510
GO:0000791	Component	Euchromatin	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21737686
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	21737686
GO:0005829	Component	Cytosol	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	24434510
GO:0006936	Process	Muscle contraction	NAS	10873377
GO:0007517	Process	Muscle organ development	NAS	11444853
GO:0008307	Function	Structural constituent of muscle	NAS	11444853
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016605	Component	PML body	IEA
GO:0031674	Component	I band	IEA
GO:0031674	Component	I band	ISS
GO:0043422	Function	Protein kinase B binding	IEA
GO:0043422	Function	Protein kinase B binding	IPI	21737686
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045662	Process	Negative regulation of myoblast differentiation	IMP	21737686
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IBA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IDA	24434510

Other IDs

• MIM: 610734
• HGNC: 495
• e!Ensembl: ENSG00000165887

Protein

• UniProt ID: Q9GZV1
• Protein name: Ankyrin repeat domain-containing protein 2 (Skeletal muscle ankyrin repeat protein) (hArpp)
• Protein function: Functions as a negative regulator of myocyte differentiation. May interact with both sarcoplasmic structural proteins and nuclear proteins to regulate gene expression during muscle development and in response to muscle stress. {ECO:0000269|PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	152 → 244	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	245 → 310	Ankyrin repeats (3 copies)	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Mostly expressed in skeletal and cardiac muscles. Found in slow fibers. Also expressed in kidney, but to a lower extent (at protein level). {ECO:0000269|PubMed:11444853, ECO:0000269|PubMed:11453652}.
• Sequence:

  MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRG
  DARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRK
  KRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQF
  RRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADT
  NVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLL
  LHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
  

• Sequence length: 360

Pathways

KEGG Pathway:

Cytoskeleton in muscle cells

Related Genes

No strongly related genes found yet for ANKRD2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ANKRD2.